KEGG   Methanopyrus kandleri: MK0731Help
Entry
MK0731            CDS       T00078                                 

Gene name
sucC
Definition
(GenBank) Succinyl-CoA synthetase beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mka  Methanopyrus kandleri
Pathway
mka00020  Citrate cycle (TCA cycle)
mka00640  Propanoate metabolism
mka00660  C5-Branched dibasic acid metabolism
mka00720  Carbon fixation pathways in prokaryotes
mka01100  Metabolic pathways
mka01110  Biosynthesis of secondary metabolites
mka01120  Microbial metabolism in diverse environments
mka01130  Biosynthesis of antibiotics
mka01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mka00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MK0731 (sucC)
   00640 Propanoate metabolism
    MK0731 (sucC)
   00660 C5-Branched dibasic acid metabolism
    MK0731 (sucC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MK0731 (sucC)
Enzymes [BR:mka01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     MK0731 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A
Motif
Other DBs
NCBI-ProteinID: AAM01945
UniProt: Q8TXE3
Position
697284..698363
Genome map
AA seq 359 aa AA seqDB search
MIRLLEYQAKHLLKEAGVPIPEGDVARTSADAARIAAELGGPVAVKAQVPVGARGKAGGI
LFADDPEGARKAARKLLGSRIRGETVRKVLVEEKLDIAEEWYVSITLDRAKRRPVLLVSR
EGGVDIEEVPDEKIARRYLDPILGLRPFEAREAILEAGIPKEHLRDVEEVITSMYEVFES
YDAHLVEINPLVLTENGEVVAADAVVNLDEDAANIRHPEFAEETRDFPFVELDGDIGIIA
NGAGLTMATIDLVKDLGGKPANFLDVGGGAYPTLIRRAILTVAELDVKVILLNIFGGITR
CDEVAEGIVQALDDVDVPLVVRLVGTNEEEGHRILREHGVDVYTELKEAVERAVELAGA
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgatcaggctgttggagtaccaggctaagcatctgctcaaggaggccggggtgccgatt
ccagaaggcgacgtcgcccgcacctcggcggacgcggcccggatcgccgccgaactcggg
ggaccggtggccgtcaaggcgcaggtgcccgtcggggcccgtggtaaagccgggggtatc
ctgttcgcggacgacccggaaggggccagaaaggccgcccggaagctgctcggctcgcgg
atccggggtgagaccgtcaggaaggtgctcgtggaagagaaactggacatagccgaggaa
tggtacgtgtccataacgctcgaccgtgcgaagcgtaggcccgtactcctcgtctcccgc
gaaggtggagtagatatcgaagaggttccggacgagaagatcgcccgcaggtacctcgac
ccgatcctaggattacgccccttcgaagctcgagaggcgatcctcgaggcgggtatcccg
aaggagcacctgcgggacgtcgaggaagtgatcacatccatgtacgaggtgttcgagagc
tacgacgctcacctcgtggagatcaacccgctagttcttacggagaacggggaggtagtg
gccgcggacgctgtcgtgaacctggacgaagacgccgccaatatccggcacccggagttc
gccgaagagacccgcgatttccccttcgtcgagctcgacggtgacatcggtatcatcgcc
aacggtgcgggtctcaccatggccaccatagatctcgttaaggatctcggtggtaagccc
gccaacttcttggacgtaggtggtggggcttacccgacgctcatccgtagagccatcctc
accgtggccgagctggacgtgaaagtgatcctcctcaacatcttcggtggcatcactcgg
tgtgacgaggtggcggaaggtatcgttcaagccctcgacgacgtggacgtcccgctcgtg
gtgaggctcgtggggacgaacgaggaggaaggtcatcgcatactccgcgagcacggggtc
gacgtctacaccgagcttaaggaggcggtcgaacgcgcggtcgagttagcgggggcttag

DBGET integrated database retrieval system