KEGG   Methanopyrus kandleri: MK0961Help
Entry
MK0961            CDS       T00078                                 

Gene name
speE
Definition
(GenBank) Spermidine synthase
  KO
K00797  spermidine synthase [EC:2.5.1.16]
Organism
mka  Methanopyrus kandleri
Pathway
mka00270  Cysteine and methionine metabolism
mka00330  Arginine and proline metabolism
mka00410  beta-Alanine metabolism
mka00480  Glutathione metabolism
mka01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mka00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    MK0961 (speE)
   00330 Arginine and proline metabolism
    MK0961 (speE)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MK0961 (speE)
   00480 Glutathione metabolism
    MK0961 (speE)
Enzymes [BR:mka01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.16  spermidine synthase
     MK0961 (speE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spermine_synth Methyltransf_30 Methyltransf_25 Methyltransf_24 Methyltransf_23 Methyltransf_11 RrnaAD
Motif
Other DBs
NCBI-ProteinID: AAM02174
UniProt: Q8TWS1
Position
complement(922744..923442)
Genome map
AA seq 232 aa AA seqDB search
MGVGEVVDNIGRGLLSEDRRAREAAARYREWAESLDEEELFRYVRERTGGLGHGKEGFEV
GKMGLKGYVIAWPEQARGMVLEIGTGLGRTTWALLRWGDPELIVSVEVDPRMLAIALYRN
PVPEFSEALRDDRVKILLGDAVEVVPKLPRGFDHVVHDGGPCPGRNPRLFSPEFLRTIAE
KLKDEGTASVFAGRDPRWQDRIYRALSRLFLEVRAESFPDTPTVVFRCEGRR
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgggggtaggagaggtggtcgataatatcggtcgcgggttactcagtgaagacaggaga
gcgcgtgaggccgccgcgcggtaccgggagtgggcggagtcgttggatgaggaggagctg
ttccgatacgtgagggaacggacgggaggattgggccacgggaaggaggggttcgaggtc
gggaaaatggggctcaaggggtacgtgatcgcgtggcccgagcaggctcgaggcatggtg
ctggagatcggtacgggattgggcagaaccacctgggcgctgttgaggtggggtgacccg
gaactgatcgtttcggtggaagtggatcctcgaatgctcgcgatcgcgttgtaccggaac
ccggtcccggagttctccgaagcgctcagggacgacagggtcaagatactactgggcgac
gccgtggaagtcgtgccgaaactcccgagaggtttcgatcatgtggttcacgacggggga
ccgtgtcctgggcgcaacccacggctgttctctcccgagttcctaaggacgatagccgag
aagctgaaggacgagggtacggcgtcggtgttcgcgggtcgagatccgcggtggcaggat
aggatataccgagccctcagtcggctctttctggaggtgagagcggaatctttcccggac
accccgaccgtggtgttccgatgtgagggacgccgttag

DBGET integrated database retrieval system