KEGG   Methanopyrus kandleri: MK0974Help
Entry
MK0974            CDS       T00078                                 

Gene name
thrC
Definition
(GenBank) Threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mka  Methanopyrus kandleri
Pathway
mka00260  Glycine, serine and threonine metabolism
mka00750  Vitamin B6 metabolism
mka01100  Metabolic pathways
mka01110  Biosynthesis of secondary metabolites
mka01120  Microbial metabolism in diverse environments
mka01230  Biosynthesis of amino acids
Module
mka_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mka00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MK0974 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MK0974 (thrC)
Enzymes [BR:mka01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MK0974 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Zn-ribbon_8 Prok-RING_1 HypA ACP_syn_III_C zf-ribbon_3 DNA_RNApol_7kD NOB1_Zn_bind TF_Zn_Ribbon zinc_ribbon_2
Motif
Other DBs
NCBI-ProteinID: AAM02187
UniProt: Q8TWQ8
Position
934272..935483
Genome map
AA seq 403 aa AA seqDB search
MHYVLECVECGSEFDDDSLVRCPECGGLLEVALRYDEIEVSRSTFEGRRLGVWAFRELLP
VNTDDPVTMSEGGTGLHPCPRLGEELGVRELFVKNEGENPTGSFKDRGMTVGVTKAVELG
AEVVACASTGNTSASLAAYAARAGLTCAVLLPAGKVALGKLAQALFHGARVIPVNGNFDD
ALDVVKKLADEGIVYILNSVNPFRLSGQRTIAYEICLQLDWEVPDAVVVPVGNAGNISAI
WQGFLDLYRLGIIDELPRMYGVQAEGARPIVEAIRRGKEDIEPDPEPETVATAIRIGNPV
NAIKALRAIRCSGGWAVEVSDEEILSAQRELATREGIFVEPASAASIAGLRKFVEEGEID
ADERVVCVTTGHGLKDPETVMEVCELPEPVEPDPETIQRLIAE
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
ttgcattacgtcctggagtgtgttgaatgcggttcggagttcgatgatgactcactggta
cggtgccccgagtgcggaggactcctggaggtggcactgcgctacgacgaaatcgaggtg
agtcggtcgacgttcgagggtcgtcgcctcggcgtatgggccttccgggagctcctacca
gtgaacacggacgatcccgtcacgatgtccgagggcggtacgggcttacacccgtgtccg
agactgggcgaggagctcggtgttagggagctgttcgtgaagaacgagggcgagaacccc
acgggctccttcaaggatcggggaatgaccgtgggagttaccaaggccgtggagctcggt
gcggaggtcgtcgcatgtgcctcgacgggcaacacatcggcctcgttggccgcctacgcc
gcccgcgcgggccttacgtgtgccgtcctccttccggccggtaaggtggccctaggcaaa
ctcgctcaagccctcttccacggtgcccgcgtgattccagtgaacggcaacttcgacgac
gccttggatgtcgtgaagaagctggccgatgagggcatcgtgtacattctaaactccgtg
aacccgttccgcctctccggtcagcgtaccatcgcgtacgagatctgcttgcagttggac
tgggaggtccccgacgcggtcgtcgtgccggtcggtaacgcgggtaacatcagcgcgatc
tggcaggggttcctcgatctctacaggctgggaatcatcgacgagctcccgaggatgtac
ggagtacaggcggagggtgctcgaccgatcgtcgaggcgattcggcggggcaaggaggac
atcgaaccggatcccgagcccgaaaccgtcgccaccgcgatccgcatcggtaacccagtg
aacgccatcaaggctctccgtgccatccggtgttcgggcggctgggccgtagaggtctcc
gacgaggaaatactctcggcgcagcgtgagctcgcaacgcgggaggggatcttcgtggag
ccggcgagtgccgcctcgatagcgggactcaggaagttcgtggaggagggtgagatcgac
gccgacgagcgggtggtctgcgtgaccaccggacacggtttgaaggatccggagacggtc
atggaagtgtgtgagctgcctgaacccgtggaaccggatcccgagaccatacagcgttta
atcgccgagtga

DBGET integrated database retrieval system