KEGG   Methanopyrus kandleri: MK1664Help
Entry
MK1664            CDS       T00078                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mka  Methanopyrus kandleri
Pathway
mka00010  Glycolysis / Gluconeogenesis
mka00051  Fructose and mannose metabolism
mka00562  Inositol phosphate metabolism
mka01100  Metabolic pathways
mka01110  Biosynthesis of secondary metabolites
mka01120  Microbial metabolism in diverse environments
mka01130  Biosynthesis of antibiotics
mka01200  Carbon metabolism
mka01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mka00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MK1664 (tpiA)
   00051 Fructose and mannose metabolism
    MK1664 (tpiA)
   00562 Inositol phosphate metabolism
    MK1664 (tpiA)
Enzymes [BR:mka01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MK1664 (tpiA)
Exosome [BR:mka04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MK1664 (tpiA)
  Exosomal proteins of bladder cancer cells
   MK1664 (tpiA)
  Exosomal proteins of melanoma cells
   MK1664 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM ThiG FMN_dh NMO Hydrolase_like His_biosynth IGPS tRNA_edit HAMP
Motif
Other DBs
NCBI-ProteinID: AAM02877
UniProt: Q8TUT9
Position
complement(1666501..1667181)
Genome map
AA seq 226 aa AA seqDB search
MLRVPPVIVNFKAYSEAVGENALRLARVAAEVSEETGVEVGICPPHVDLRDVVREVGDEV
TVLAQAVDAAEPGGRTGHVTPEMVVEAGADGTLLNHSERRMLLEDLKDVCRACINEGLLT
IVCASDALAARAAGALSPHAVAVEPPELIGTGTPVSKADPEVVERSVEVVKEVSEETAVL
CGAGITDGSDVRAAVELGADGVLVASGVVLADDPKEALLDLISGLE
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgtgtacctcctgttatcgtgaatttcaaggcgtactcggaagcggtcggtgag
aacgcactacgactggctcgagtggccgcggaagtgtcggaagaaaccggagtcgaggtc
gggatctgtcctcctcatgtcgacctgcgcgacgtggttagggaggtaggcgacgaagtc
acggtcctagcgcaggcagttgatgcggccgagcccggcgggaggaccgggcacgtgact
cccgagatggtggtcgaagccggcgccgacgggacgcttctgaaccactcggaacgccgg
atgctgttggaggatcttaaggacgtctgccgagcgtgcataaacgagggtctcctcacg
atcgtgtgtgcgagcgacgcgctcgccgcccgtgcggccggggccctctcgcctcacgcg
gtggccgtggagccgccggagctcatcggtacggggaccccggtgtcgaaggccgacccc
gaggtagtcgagcgatcggtcgaggtcgtgaaggaggtctcggaggagacggccgtactg
tgcggggccgggatcaccgatgggtccgatgtgcgtgccgccgtggaattgggtgctgat
ggcgtcttagtagcttctggagtggtattagcggacgatcctaaggaggcgttattagac
ctcatctccggcctagaatag

DBGET integrated database retrieval system