KEGG   Methylacidiphilum kamchatkense: kam1_1254Help
Entry
kam1_1254         CDS       T06102                                 

Gene name
cbbS
Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
mkc  Methylacidiphilum kamchatkense
Pathway
mkc00630  Glyoxylate and dicarboxylate metabolism
mkc00710  Carbon fixation in photosynthetic organisms
mkc01100  Metabolic pathways
mkc01110  Biosynthesis of secondary metabolites
mkc01120  Microbial metabolism in diverse environments
mkc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mkc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    kam1_1254 (cbbS)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    kam1_1254 (cbbS)
Enzymes [BR:mkc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     kam1_1254 (cbbS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: QDQ42480
UniProt: A0A0C1UMH8
Position
complement(1244989..1245405)
Genome map
AA seq 138 aa AA seqDB search
MRITQGTFSYLPDLTDEEIAAQVQYIIDQGWSVMIEYTDDPHPRNTYWDMWGLPLFDIKD
PAAVMEELNNCRKAFPNHYIKISGYNRQQGYQTTMISFICNRPKEEPGFALQRTEWEDRQ
QKYQIKPYALDKPKGQRY
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgagaattacccaaggtaccttttcttatctgcctgacttgactgatgaagaaatagct
gctcaggttcaatatattatagaccagggatggtcggtcatgattgaatataccgacgat
cctcatccgcggaatacttattgggatatgtggggactgcctctgtttgatatcaaagat
ccggcggcggtcatggaggagttaaataattgccgaaaggcttttccaaaccattatatt
aagattagtggttataacaggcagcagggctatcaaacgaccatgatcagctttatttgc
aaccggccgaaagaagagcctggttttgcactacaaagaacggaatgggaagataggcag
cagaagtaccagattaagccctatgcgttggataagccaaagggtcaacggtactaa

DBGET integrated database retrieval system