KEGG   Methylacidiphilum kamchatkense: kam1_13Help
Entry
kam1_13           CDS       T06102                                 

Definition
(GenBank) phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
mkc  Methylacidiphilum kamchatkense
Pathway
mkc00564  Glycerophospholipid metabolism
mkc01100  Metabolic pathways
mkc01110  Biosynthesis of secondary metabolites
Module
mkc_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:mkc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    kam1_13
Enzymes [BR:mkc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     kam1_13
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase DUF4131
Motif
Other DBs
NCBI-ProteinID: QDQ41276
UniProt: A0A516TJ82
Position
11345..11992
Genome map
AA seq 215 aa AA seqDB search
MKDSLLFREAFPIAFALATLSLIFLLLPFKPAKFVGVFFLLALLFLFYFFRNPERTIPTD
PHYILAPADGKIVEIKMEETSPFYEGKATKISIFLSIFDVHVNRSPVDGKIIKKEYHKGI
FLDARNPKASLLNERQDWWIQSTKGCIVGIRQIAGFIARRLVSWKETGETIKRGERIGMI
KFGSRTELFLPSDCIVVVHNGEKVEAGKTVVAKWP
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaaagattcccttctttttcgtgaggcatttcccattgcttttgccctagcgacgcta
tctttgatcttcttgcttttacccttcaaaccagcaaaatttgtaggggtctttttttta
ttagcccttctttttctcttttatttcttcagaaatccagaaagaactatccctactgat
cctcattatattttggctccagcagacggcaaaattgtggaaataaaaatggaagaaaca
tctcctttctatgaggggaaggcaacaaaaatatctatatttctttctatctttgatgtg
catgtgaaccgttctccggttgatggcaaaattattaagaaagagtaccataaagggatt
tttttggatgcacgcaatccaaaggcctctttattaaacgaaagacaggattggtggatt
caatcgacaaaaggatgtattgtaggaataagacagattgctgggtttattgcgcgccgg
ttggtttcttggaaagaaactggtgagacgattaaaaggggagaaagaattggcatgatt
aagtttggatctagaacagaactttttcttccaagcgactgtatagtggtagtacataat
ggagagaaagtggaagctgggaaaacggtagttgcaaaatggccatga

DBGET integrated database retrieval system