KEGG   Methylacidiphilum kamchatkense: kam1_1616Help
Entry
kam1_1616         CDS       T06102                                 

Definition
(GenBank) uncharacterized protein
  KO
K06195  ApaG protein
Organism
mkc  Methylacidiphilum kamchatkense
Brite
KEGG Orthology (KO) [BR:mkc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    kam1_1616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: QDQ42831
UniProt: A0A0C1UTW2
Position
complement(1626918..1627304)
Genome map
AA seq 128 aa AA seqDB search
MEEFLKVNEIKVIIEHLEYERSKSHSSNYLYVCFYYISILNFSPKTVLLKGRKWIVTNDL
GEKTVIEGMGIVGTYPRLKMGEKFRYSSHHFYSRPSVVEGSYFGIDSEGSLIVIPVPKFS
LLIPEDIF
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggaagaatttttaaaagtcaatgagatcaaagtaattattgaacatctcgaatatgaa
cgctccaaaagccattcttccaattatctttatgtctgtttttattatatttcgattctg
aattttagtcccaaaacagtgctcttaaaaggtagaaaatggatagtgaccaacgactta
ggtgaaaaaacggtaattgaaggcatggggattgttgggacttatccaaggttgaagatg
ggagaaaagttccgttattcaagccatcatttctattcgagacctagcgtcgtcgaaggc
tcttattttggcattgattcagaaggttctctgattgtgatccctgtccctaagttttct
cttttgattcctgaagatattttttag

DBGET integrated database retrieval system