KEGG   Methylacidiphilum kamchatkense: kam1_968Help
Entry
kam1_968          CDS       T06102                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mkc  Methylacidiphilum kamchatkense
Pathway
mkc00020  Citrate cycle (TCA cycle)
mkc00480  Glutathione metabolism
mkc01100  Metabolic pathways
mkc01110  Biosynthesis of secondary metabolites
mkc01120  Microbial metabolism in diverse environments
mkc01130  Biosynthesis of antibiotics
mkc01200  Carbon metabolism
mkc01210  2-Oxocarboxylic acid metabolism
mkc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mkc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    kam1_968
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    kam1_968
Enzymes [BR:mkc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     kam1_968
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Iso_dh TT1725
Motif
Other DBs
NCBI-ProteinID: QDQ42201
UniProt: A0A0C1RJZ6
Position
955777..957222
Genome map
AA seq 481 aa AA seqDB search
MKKVPITVAYGDGIGPEIMEATLKVLFAAGAELEIETIEIGQKIYMQGNPTGIDPSAWES
LKRTKVFLKAPITTPQGGGFKSLNVTFRKALGLFANVRPCVAYHPFIFTKHPKLDLVIVR
ENEEDLYSGIEHRQSIDSYQALKVLSFQGTERIIRYAFEYARCFQRKKVSCFTKDNILKI
TDGMFHKVFERVGQEYPDIEKEHWIIDIGSAKLADSPESFDVIVLANLYGDILSDVAVQI
AGSVGLGSSANIGDRYAMFEAIHGSAPRRAGQNVANPSGLLLAAVQMLIHIGQNAVADRV
YNAWLRTIEEGIHTYDIFREGVSRKKVGTKEFSDQIIQNLGKEPEVLKPFCSTKFKENPK
TNFSIVLPQERKELVGVDVFVEYPPYPAQLANHLKGCSDPFILESIANRGMSVWPACFEE
ALLAGPYQCRFIKNKENNSTISHGDVVRLLDRIQKIGLEFTKTELLYTFNGIEGYSRSQG
E
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtaccaattactgttgcttatggagatggcattgggccggaaatcatggag
gccactttaaaagtcctttttgctgctggagctgagttggagattgagaccatagaaatt
ggtcaaaaaatttatatgcagggaaaccccactgggatcgatccttcagcttgggaaagt
ctaaaaagaacaaaagtttttttaaaggcaccaataacaactccacagggaggtggcttt
aaaagcttgaatgtcacctttagaaaagctttagggctttttgcaaatgtaaggccttgt
gtagcttatcatccttttatttttacaaaacatccaaaattggacttagttattgtcaga
gaaaacgaagaggatctttacagtggaatagaacatagacagagtattgattcctatcaa
gccttgaaagttttgtcttttcagggaaccgaaagaattattcggtatgcttttgaatat
gctcgttgctttcaaagaaagaaagtgagttgttttacaaaggataacatcttaaaaatt
acagatgggatgtttcataaggtttttgaaagggttgggcaagaatatccagatattgaa
aaggagcattggattattgatattggttcggctaaactcgctgacagtccagaatccttt
gatgtgattgttctggctaatctctacggggacattctatccgatgtagccgttcagatt
gcaggatctgttggccttggttcttcggccaatattggtgatagatatgctatgtttgaa
gctattcatggatctgcgcctaggagagccggacagaatgttgccaatccttctgggctt
cttttggccgctgttcaaatgcttattcacattggacaaaatgcggttgctgatcgcgtc
tataatgcttggcttaggaccatagaggaaggcattcatacgtatgacatttttagagaa
ggggtcagtagaaaaaaagttggtacaaaagaattttccgatcaaatcatccagaattta
gggaaagaaccggaggtattaaaacctttttgttccactaaatttaaagaaaatcctaaa
acaaatttttctattgttcttcctcaagaaagaaaagagctagttggagtagatgttttt
gttgaatatcctccttatccagctcaattagcaaaccatttaaagggctgttctgatcca
tttattttggaatcgattgcgaatagaggcatgtccgtatggcctgcttgctttgaggaa
gctttgttggctggtccctatcaatgccgttttattaaaaataaagaaaataattcaacc
atttctcatggtgatgttgttagacttttggatcgaatccagaaaattggattggaattc
actaaaacagagttattgtatacttttaacggaatagagggatattctcgtagccagggg
gaataa

DBGET integrated database retrieval system