KEGG   Mycobacterium kansasii 824: LH54_11890Help
Entry
LH54_11890        CDS       T03653                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mki  Mycobacterium kansasii 824
Pathway
mki00071  Fatty acid degradation
mki00072  Synthesis and degradation of ketone bodies
mki00280  Valine, leucine and isoleucine degradation
mki00310  Lysine degradation
mki00362  Benzoate degradation
mki00380  Tryptophan metabolism
mki00620  Pyruvate metabolism
mki00630  Glyoxylate and dicarboxylate metabolism
mki00640  Propanoate metabolism
mki00650  Butanoate metabolism
mki00900  Terpenoid backbone biosynthesis
mki01100  Metabolic pathways
mki01110  Biosynthesis of secondary metabolites
mki01120  Microbial metabolism in diverse environments
mki01130  Biosynthesis of antibiotics
mki01200  Carbon metabolism
mki01212  Fatty acid metabolism
mki02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mki00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LH54_11890
   00630 Glyoxylate and dicarboxylate metabolism
    LH54_11890
   00640 Propanoate metabolism
    LH54_11890
   00650 Butanoate metabolism
    LH54_11890
  Lipid metabolism
   00071 Fatty acid degradation
    LH54_11890
   00072 Synthesis and degradation of ketone bodies
    LH54_11890
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LH54_11890
   00310 Lysine degradation
    LH54_11890
   00380 Tryptophan metabolism
    LH54_11890
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LH54_11890
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LH54_11890
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LH54_11890
Enzymes [BR:mki01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LH54_11890
Exosome [BR:mki04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LH54_11890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C Phage_lysis
Motif
Other DBs
NCBI-ProteinID: AIR28255
Position
2625978..2627138
Genome map
AA seq 386 aa AA seqDB search
MGNPVIVEATRSPIGKRNGWLSGLHATELLGAVQKALVHKAGIDAGDVEQVIGGCVTQFA
EQSNNISRTAWLTVGLPDHVGATTIDCQCGSGQQANHLIAGLISAGAIDVGIACGIEAMS
RVGLGANAGPDRNWRAESWDIDMPNQFEAAERIAKRRGITREDIDVFGFQSQLRAKRAWD
EGRFDREISPIEAPVLDEQKQPTSERHMVTRDQGLRDTTMEGLSQLKPVLEGGIHTAGTS
SQISDGAAAVLWMDEDKAKALGLKPRARIVSQALVGAEPYYHLDGPVQSTAKVLEKAGMK
MGDIDITEINEAFASVVLSWARVHEPDMDRVNVNGGAIALGHPVGCTGSRLITTALHELE
RTDQSTALITMCAGGALSTGTIIERI
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacccggtaatcgtcgaggccacacgcagcccgatcggcaagcgaaatgggtgg
ttgtcaggtctgcacgccaccgagctgctcggagcggtgcagaaggcactggtgcacaag
gccgggatcgatgcgggagacgtcgaacaggtcatcggcggctgcgtgacccaattcgcg
gagcagtccaacaacatcagccgcaccgcgtggttgactgtggggttgcccgaccacgtc
ggcgccaccaccatcgactgccagtgcggcagcgggcagcaggccaatcacctgatcgcc
gggctgatctcggccggcgcgatcgacgtcggcatcgcctgcggaatcgaggcgatgagc
cgggtcggcttaggggccaacgcggggccggaccgcaactggcgggccgagtcgtgggac
atcgacatgcccaaccagttcgaggccgctgagcgaatcgccaagcgccgcggcatcacc
cgcgaggacatcgatgtcttcgggttccagtcgcaattgcgcgccaagcgcgcctgggac
gagggccgtttcgaccgggaaatctcgcccatcgaggcgccggtgctcgacgagcaaaag
caacccaccagcgagcgccatatggtcacccgcgaccagggcctgcgggacaccaccatg
gaggggctgagccagctgaaaccggtgctggaaggcggcattcacaccgcgggcacgtca
tcgcagatctccgacggcgcggccgcagtgttgtggatggacgaagacaaggccaaggca
ctcggcttgaagccgcgcgcccggatcgtcagccaggcgctcgtcggcgcggagccctac
taccacctcgacggtccggtgcagtcgacggcgaaggtgctcgaaaaggccggcatgaag
atgggcgacatcgacatcaccgagatcaacgaggcgttcgcctccgtggtgctgtcctgg
gcgcgggtccacgagccggacatggatcgggtcaacgtcaacggcggtgcgatcgcattg
ggccatccggtggggtgcaccggcagccggctgatcaccaccgcattgcacgagctggag
cgcacggaccaaagcaccgcgctgatcaccatgtgcgccggcggtgccctgtccaccggg
accatcatcgaaagaatctga

DBGET integrated database retrieval system