KEGG   Mycobacterium sp. KMS: Mkms_0120Help
Entry
Mkms_0120         CDS       T00442                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00010  Glycolysis / Gluconeogenesis
mkm00071  Fatty acid degradation
mkm00350  Tyrosine metabolism
mkm00625  Chloroalkane and chloroalkene degradation
mkm00626  Naphthalene degradation
mkm01100  Metabolic pathways
mkm01110  Biosynthesis of secondary metabolites
mkm01120  Microbial metabolism in diverse environments
mkm01130  Biosynthesis of antibiotics
mkm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mkms_0120
  Lipid metabolism
   00071 Fatty acid degradation
    Mkms_0120
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mkms_0120
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mkms_0120
   00626 Naphthalene degradation
    Mkms_0120
Enzymes [BR:mkm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mkms_0120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N NAD_binding_2 Glu_dehyd_C ADH_zinc_N_2 UDPG_MGDP_dh_N TrkA_N FAD_binding_3 Mur_ligase 2-Hacid_dh_C 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ABL89338
UniProt: A1U930
Position
complement(133344..134456)
Genome map
AA seq 370 aa AA seqDB search
MTMTIRGAVLEEIGRPRPFTESAPLSVSELQLDPPGPDELLIRIEAAGLCHSDLSVVDGN
RVRPVPMLLGHEAAGIVEQIGPGGSDLEVGQRVVMTFLPRCGHCTACATGGLTPCEPGTA
ANSAGTLMHGDIRLHRDGQPVHHHLGVSGFATYAVVDRHSVVAVDADVPPVVASLLGCAV
LTGGGAVLNVGKPQPGQTVVVVGLGGVGMAAMITAMAHDGVDVVGIDQLEDKLDRARAMG
INAAYTPEEAAERGLKAAVVIEAVGHPSALETAIAHTAPGGRTITVGLPRPDARISVSPL
GFVAEGRSLIGSYLGSAVPARDIPRFVELWRSGRLPVETLVSSTISLDEINAGMDRLAEG
KAVRQVIEFD
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgacgatccgcggcgccgtcctcgaagagatcggccggccccgccctttcacc
gagtccgcgccgctgtccgtgtccgaactccagctcgatccgcccggccccgacgaactg
ctgatccggatcgaggccgcgggtctgtgccactcggatctctcggtcgtcgacggcaac
cgcgtgcggccggttccgatgctgctcggccacgaagccgccggcatcgtcgagcagatc
ggtccgggcggctccgacctcgaggtgggtcagcgggttgtgatgacgttcctgccgcgc
tgcggccactgcaccgcctgtgccaccggcggtctcaccccgtgcgaaccgggcaccgcg
gccaacagcgccggcaccctcatgcacggcgacatccggctgcaccgcgacggccaaccg
gtgcaccatcacctcggggtgtccggtttcgccacttacgccgtggtggaccggcattcg
gtggtcgccgtcgacgccgacgtcccaccggtcgtcgcgtcgctgctcggttgcgcggtc
ctcaccggcgggggcgcggtgctcaacgtcggcaaaccgcaacccggccagaccgtcgtc
gtggtcggcctcggcggcgtcgggatggccgcgatgatcaccgccatggcgcacgacggc
gtggacgtcgtcgggatcgaccagctggaggacaaactcgaccgagcccgcgcgatgggc
atcaacgccgcctacaccccggaggaggccgctgaacggggcctcaaggcagcggtggtc
atcgaagcggtcggccacccctccgcactcgagaccgcgatcgcgcacaccgctcctggt
ggccgcacgatcaccgtcggcctcccccgccccgatgcgcggatctcggtgtcgccgttg
ggtttcgtcgccgaaggccggtccctgatcggcagttacctcgggtcggcggtgccggcc
cgcgacatcccccggttcgtcgagctgtggcgctctggtcgtctcccggtggaaaccctg
gtgtcctcgacgatctcactcgacgagatcaatgccggtatggaccgcctggccgagggc
aaggccgtccgccaggtcatcgagttcgactag

DBGET integrated database retrieval system