KEGG   Mycobacterium sp. KMS: Mkms_0550Help
Entry
Mkms_0550         CDS       T00442                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00430  Taurine and hypotaurine metabolism
mkm00620  Pyruvate metabolism
mkm00640  Propanoate metabolism
mkm00680  Methane metabolism
mkm01100  Metabolic pathways
mkm01120  Microbial metabolism in diverse environments
mkm01200  Carbon metabolism
Module
mkm_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:mkm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mkms_0550
   00640 Propanoate metabolism
    Mkms_0550
  09102 Energy metabolism
   00680 Methane metabolism
    Mkms_0550
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Mkms_0550
Enzymes [BR:mkm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     Mkms_0550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: ABL89766
UniProt: A1UAA8
Position
603532..604731
Genome map
AA seq 399 aa AA seqDB search
MTRTVLVLNSGSSSLKFQLLEPDSGASLADGIVERIGEDSSSASLVCGEREVTHSERVPD
HEAALRTAYGLFDEAGAELGSVGLVAVGHRVVHGGPDLYQPTLIDDALVDTLESLAPLAP
LHNPPAVLGIRGARKAFPDLPHVAVFDTAYFHDLPVAAATYAIDRDLSEQWHIRRYGFHG
TSHQYVSEQAALFLDVPLSSLSQIVLHLGNGASASAILGGRPIDTSMGLTPMEGLVMGTR
SGDVDPGVLVYLWRTAGMSVDEIETMLNKRSGVRGLGGEIDFRVLHQRIESGDESDRENA
QLAYDVYIHRLRKYIGAYLALLGSTDVIVFTAGVGENDAAVRRDALSGMGRLGIELDEHL
NESPSHTARRISAETSPTTVLVIPTNEELAIARACVEVI
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcacagtgctcgtgctcaactccgggtcctcgtcgctgaaattccaactgctc
gaaccggactccggggcctcactggccgacgggatcgtcgagcgcatcggtgaggattcg
tcgtcggcgagcctggtgtgcggcgagcgggaggtcacgcacagcgagcgggtacccgac
cacgaggccgcgctacgtacggcatacggcctgttcgacgaggccggcgccgaattgggc
agcgtcggtctcgtggcggtcgggcaccgcgtcgtgcatggtgggcccgatctctaccag
ccgacgctgatcgacgacgcgttggtcgacacgctcgagagcctggccccgttggcgcct
ctgcacaacccgcccgcggtcctcggcatacgcggggctcgtaaggccttcccggacctg
ccccacgtcgcggtgttcgacaccgcctacttccacgacctaccggttgcggcagccaca
tacgcgatcgaccgggacctctccgagcagtggcacatccggcgttacgggtttcacggc
acctcacaccagtacgtcagtgagcaggcggcgctgttcctcgacgtcccgctgtcgtcg
ctcagccagatcgtgttgcacctcggcaacggagcgtcggcgtcggcgatcctcggcggc
cgcccgatcgacacctcgatgggcctgacgccgatggagggtctggtgatgggcacccga
tccggcgacgtcgacccgggagtgctcgtatacctctggcgcacagcgggaatgagcgtc
gacgagatcgagacgatgctcaacaagcggtccggggtccgtggtctcggcggtgagatc
gacttccgggtgctgcaccagcggatcgaaagcggtgacgaatccgaccgggagaacgcg
caactggcctacgacgtgtacatccaccggctgcggaagtacatcggcgcgtacctcgcg
ctgctggggagcaccgacgtgatcgtcttcaccgcaggtgtgggcgaaaacgacgccgcc
gtgcgacgcgacgcgctgtcgggcatgggacggctgggcatcgagttggacgagcatctc
aacgagagcccgtcgcacacggcgcggcgcatctcggcggagacgtcgcccaccacggtg
ctcgtcatccccaccaacgaggagttggcgatcgcccgggcgtgcgtggaggtcatctga

DBGET integrated database retrieval system