KEGG   Mycobacterium sp. KMS: Mkms_1395Help
Entry
Mkms_1395         CDS       T00442                                 

Definition
(GenBank) muconolactone delta-isomerase
  KO
K03464  muconolactone D-isomerase [EC:5.3.3.4]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00362  Benzoate degradation
mkm01100  Metabolic pathways
mkm01120  Microbial metabolism in diverse environments
mkm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mkms_1395
Enzymes [BR:mkm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.4  muconolactone Delta-isomerase
     Mkms_1395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MIase
Motif
Other DBs
NCBI-ProteinID: ABL90607
UniProt: A1UCP9
Position
1498970..1499248
Genome map
AA seq 92 aa AA seqDB search
MLFHVRMDVRIPHDLDPQARIDLVSREKAYSQELQRAGKWPQIWRIAGEYSNFSVFDVES
NDELHELVSALPLFPYMDIHVTPLARHPSDVK
NT seq 279 nt NT seq  +upstreamnt  +downstreamnt
atgctgttccacgtacgaatggacgtgcggatcccgcacgacctcgatccgcaggcgcgc
atcgacctggtctcccgcgagaaggcctattcccaggagttgcagcgagccgggaagtgg
ccgcagatctggcgcatcgccggtgagtactcaaacttctcggtcttcgacgtcgagtcg
aacgatgaactgcacgagctggtctcggctctgccgttgttcccctacatggacatccac
gtcacgccgctggcccggcacccctccgacgtcaaatga

DBGET integrated database retrieval system