KEGG   Mycobacterium sp. KMS: Mkms_1731Help
Entry
Mkms_1731         CDS       T00442                                 

Definition
(GenBank) 3-oxoacid CoA-transferase, B subunit
  KO
K01032  3-oxoadipate CoA-transferase, beta subunit [EC:2.8.3.6]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00362  Benzoate degradation
mkm01100  Metabolic pathways
mkm01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mkm00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mkms_1731
Enzymes [BR:mkm01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.6  3-oxoadipate CoA-transferase
     Mkms_1731
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans
Motif
Other DBs
NCBI-ProteinID: ABL90933
UniProt: A1UDM5
Position
1846495..1847217
Genome map
AA seq 240 aa AA seqDB search
MTRTVDASTRACVEHLDRGPLDRREIAAMIARDIPAGSYVNLGIGQPTMVADFLDPAAGV
VLHTENGMLGMGGEAIGDAIDPDLTNAGKIPVTETPGASYFHHADSFAMMRGGHLDVCVL
GAFQVSERGDLANWHTGAPDAIPAVGGAMDLAIGAKSVLVMMTLFAKDGTAKLVPSCSYP
LTGLRCVNRVYTDYAVFDIDHTGGGQLRVLHTFGLSIAALEERMRMALSCDGRVADLRQC
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgacgagaacagtcgacgcatcgacccgcgcctgtgtcgagcacctcgaccggggcccg
ctcgaccgtcgggagatcgccgcgatgatcgcccgcgacatccccgcgggttcgtacgtc
aacctcggcatcgggcagcccaccatggtcgctgacttcctggaccccgccgcgggggtc
gtgttgcacaccgagaacgggatgctcgggatgggtggggaggcgatcggcgacgcaatc
gatccggatctgacgaacgccggcaagatcccggttaccgaaacccctggggcatcctac
ttccaccacgccgactccttcgccatgatgcgcggcggtcatctcgatgtctgtgtcctc
ggcgcgtttcaggtcagcgagcgcggggatctcgccaactggcacaccggggcgcctgac
gccatacccgccgtcggcggcgcgatggatcttgctatcggcgcgaagagcgtattggtc
atgatgaccctgttcgcaaaggacggaaccgccaaactggttccttcgtgcagctatcca
ctgaccggacttcgatgcgtcaatcgggtgtacaccgactatgccgtgtttgacatcgac
cacaccggtggcggccagctgcgggtcttgcacacgttcgggctcagcattgccgcgctc
gaggagcggatgcgcatggcactctcgtgtgatggacgcgtcgctgatcttcgtcaatgc
tga

DBGET integrated database retrieval system