KEGG   Mycobacterium sp. KMS: Mkms_1914Help
Entry
Mkms_1914         CDS       T00442                                 

Definition
(GenBank) (1->4)-alpha-D-glucan branching enzyme
  KO
K16149  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00500  Starch and sucrose metabolism
mkm01100  Metabolic pathways
mkm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mkms_1914
Enzymes [BR:mkm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Mkms_1914
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 DUF1957
Motif
Other DBs
NCBI-ProteinID: ABL91113
UniProt: A1UE55
Position
complement(2031695..2033260)
Genome map
AA seq 521 aa AA seqDB search
MSDDARVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWSASYLPLMRVLRRLAGEGRDH
LLTLGMTPVVTAQLDDPYCLTGMHSWLANWQLRALEAATLRASSDTTPACTPEALRAFGV
REQGEAELALEEFATLWRHGGSPLLRELVDAGTVELLGGPLAHPFQPLLNPRLREFALRE
GLADAGQRFAHTPRGIWAPECAYAPGMEADYAAAGVGHFMVDGPSLHGDTALGRPVGHSG
VVAFGRDLQVSYRVWSPKSGYPGHAAYRDFHTYDHVTGLKPARVTGRNVPSSAKAPYEPD
RADAAIDAHVADFVQVVRRRLTDESERIGRPAHVVAAFDTELFGHWWYEGPEWLARVLRA
LPEAGVRVGTLSDAVDGGFVGAPVDLPPSSWGSGKDWQVWAGDQVTDFVRLNAEVVDTAL
STVDKALTQRASVGSPTPRDTVADQILRETLLTVSSDWPFMVSKDSAADYARYRAHLHAH
ATREIADALAAGRREQAQRLADGWNRADGLFGALDARRLPR
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacgacgctcgggtaccggggctgttcaccctcgtcctgcacacgcatctgccg
tggctggcgcaccacggccgctggccggtcggcgaggagtggctctaccagtcgtggtcg
gcgtcgtacctgccgctgatgcgcgtgctgcgcaggctggccggggagggccgcgaccat
ctgctcaccctcgggatgacaccggtggtgaccgctcagctcgacgacccctactgcctg
accgggatgcacagctggctggcgaactggcagctgcgggcactggaggccgccaccctg
cgcgcctcctcggacaccacaccggcgtgcacaccggaagcgttgcgcgccttcggtgtt
cgcgagcagggcgaagcggagctggcgctcgaggagttcgccacactgtggcgccacggc
ggcagtccgctgctgcgtgagctcgtcgacgcgggcaccgtcgaactgctgggcgggccg
ctggcgcatccgttccagccgttgctcaacccccgactgcgggagttcgcgctgcgcgaa
gggctcgccgacgccggacagcgcttcgcgcacaccccgcgcggcatctgggccccggag
tgcgcgtacgccccgggcatggaggccgactatgccgcggcgggcgtcggccacttcatg
gtcgacggcccgtcgctgcacggcgacaccgcgctaggccgccccgtcggccactccggc
gtcgtcgcgttcggtcgcgacctgcaggtcagctaccgcgtgtggtcgcccaagtccggc
tatcccggccacgccgcctaccgcgacttccacacctacgaccacgtcaccgggttgaag
ccggcgcgggtcaccgggcgcaacgtgccgtcgtcggccaaagccccatacgaaccggac
cgcgccgacgccgccatcgacgcccacgtcgccgacttcgtgcaggtggtgcggcggcgg
ctgacggacgagagcgagcggatcggccgcccggcgcacgtggtcgccgccttcgacacc
gaactgttcggccactggtggtacgaggggccggagtggctggcccgcgtactgcgggcg
ctgccggaagccggtgtgcgggtgggcacgctcagcgatgccgtcgacggcggattcgtc
ggcgccccagtcgatctgccgcccagttcgtggggttcgggtaaggactggcaggtctgg
gccggagaccaggtgaccgacttcgtccgactcaacgccgaggtcgtcgacaccgcgctc
agcaccgtcgacaaggcgctcacccagcgcgcgtcggtgggcagcccgacaccgcgggac
accgtcgccgaccagatcctgcgcgagaccctgctgaccgtctcgagcgactggccgttc
atggtgagcaaggactccgcggccgactacgcccgctaccgcgcccacctgcacgcccac
gcgacccgcgagatcgccgacgcactcgcggccggccggcgggagcaggcccagcgcctc
gccgacggctggaaccgcgccgacggcctgttcggcgccctcgacgcccgccggttgccg
cgatga

DBGET integrated database retrieval system