KEGG   Mycobacterium sp. KMS: Mkms_1972Help
Entry
Mkms_1972         CDS       T00442                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K14941  2-phospho-L-lactate guanylyltransferase [EC:2.7.7.68]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00680  Methane metabolism
mkm01120  Microbial metabolism in diverse environments
Module
mkm_M00378  F420 biosynthesis
Brite
KEGG Orthology (KO) [BR:mkm00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    Mkms_1972
Enzymes [BR:mkm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.68  2-phospho-L-lactate guanylyltransferase
     Mkms_1972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CofC NTP_transf_3 DUF2064 CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABL91171
UniProt: A1UEB3
Position
complement(2091654..2092310)
Genome map
AA seq 218 aa AA seqDB search
MRGTTSNGAAPSGAGVAVVIAVKRLADAKTRLAPIFAPHDRETVVLAMLVDTVAAAAAVA
AVTVVTPDPAAAEAARALGAQVLDDPTPAGHPDPLNNALRAAEAAVRATVPNVVALQGDL
PALQAQELSEAIAAARTRPRSFVGDRHGTGTSALFAFGVPLDPRFGPDSAERHRRSGAVE
LTGSWPGLRYDIDTPDDLLAARRLGVGTQTARAVGAER
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgcgcggcacgacaagcaacggcgccgccccgtccggcgccggcgtggcggtggtcatc
gccgtcaaacgcctcgccgacgccaagaccaggctggcgccgatcttcgccccgcacgac
cgggagacggtggtgctggcgatgctcgtcgacaccgtcgcggcggccgccgcggtcgcg
gcggtcaccgtcgtcaccccagatcccgccgcggccgaggccgcccgcgcgctgggcgca
caggtgctcgacgatccgacgccggccggccaccccgacccgctcaacaacgcgctgcgc
gccgccgaggccgctgtgcgcgcgaccgtcccgaatgtcgttgcgctgcaaggcgatctt
cccgcgctgcaggcacaggagttgagtgaggcgatcgccgccgcgcggacacggccccgc
agcttcgtcggcgaccggcacggcaccggcacctcggcactgttcgcgttcggcgtcccg
ctggacccgcggttcggtcccgattccgcggagcggcaccggcgttcgggcgcggtcgag
ctgaccggctcgtggcccggtctgcgctacgacatcgacacccccgacgatctgctggcg
gcccgccgcctcggcgtcggcacgcagaccgcgcgtgccgtcggcgccgaaagatga

DBGET integrated database retrieval system