KEGG   Mycobacterium sp. KMS: Mkms_3829
Entry
Mkms_3829         CDS       T00442                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K12466  (+)-trans-carveol dehydrogenase [EC:1.1.1.275]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00903  Limonene and pinene degradation
mkm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mkm00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mkms_3829
Enzymes [BR:mkm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.275  (+)-trans-carveol dehydrogenase
     Mkms_3829
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Pterin_bind
Other DBs
NCBI-ProteinID: ABL93022
UniProt: A1UJL4
Position
4042729..4043565
AA seq 278 aa
MAGRVEGKVAFITGAARGQGRAHAVRLAQEGADIIAVDICKQIDSVRIPLSTPEDLAETA
DLVKGLNRRIYTAEVDTRDFEALKAAVDAGVEQLGRLDIIVANAGIGNGGETLDKTSDGD
WEDMIDVNLGGVWKTVKAGVPHILAGGRGGSIILTSSVGGLKAYPHTGHYVAAKHGVVGL
MRTFAVELGAQNIRVNSVHPTNVNTPLFMNEGTMKLFRPDLENPGPEDMKVVGQMMHTLP
IGWVEPEDIANAVLFLASDEARYITGVTLPVDGGSCLK
NT seq 837 nt   +upstreamnt  +downstreamnt
atggcaggacgggtagaaggcaaagtcgcattcatcacgggtgcggcccgcggacagggc
cgggcccacgcggtgcgactggcgcaggagggcgccgacatcatcgccgtcgacatctgt
aagcagatcgacagcgtccggatccccctgtcgacccccgaggatctcgccgagaccgcc
gatctggtgaagggactcaaccgccgcatctacaccgccgaggtcgacacccgcgacttc
gaggcgttgaaggccgctgtggacgccggtgtggagcagctgggccggctcgacatcatc
gtcgccaacgccggtatcggcaacggcggggagacgctggacaagaccagcgacggcgac
tgggaagacatgatcgacgtcaacctcggcggcgtgtggaagaccgtcaaagccggcgta
ccgcacatcctcgccggcgggcgtggcggttcgatcatcctcaccagctccgtcggcggc
ctcaaggcctatccgcacaccggccactacgtggcggccaaacacggtgtggtgggcctg
atgcggacgttcgccgtcgagttgggggcgcagaacattcgcgtgaactcggtgcatccg
accaacgtcaacacgccgctgttcatgaacgaaggcaccatgaagctgttccgtcccgac
ctggagaacccgggccccgaggacatgaaggtcgtcgggcagatgatgcacacgctgccg
atcggctgggtcgagccggaggacatcgccaacgcggtgctgttcctcgcctccgacgag
gcccgctacatcaccggcgtcacgctgcccgtcgacggcggcagctgcctcaagtaa

DBGET integrated database retrieval system