KEGG   Mycobacterium sp. KMS: Mkms_3969Help
Entry
Mkms_3969         CDS       T00442                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00260  Glycine, serine and threonine metabolism
mkm00750  Vitamin B6 metabolism
mkm01100  Metabolic pathways
mkm01110  Biosynthesis of secondary metabolites
mkm01120  Microbial metabolism in diverse environments
mkm01230  Biosynthesis of amino acids
Module
mkm_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mkms_3969
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mkms_3969
Enzymes [BR:mkm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mkms_3969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABL93161
UniProt: A1UK03
Position
complement(4181869..4182951)
Genome map
AA seq 360 aa AA seqDB search
MSTPVNAVHRRWPGLIEAYRDRLPVGDDWTPVTLLEGGTPLIHAKRLSEFTGCTVHLKVE
GLNPTGSFKDRGMTVAVTESAASGKQAVLCASTGNTSASAAAYAARAGITCAVLIPQGKI
AMGKLAQAVMHGAKIIQIDGNFDDCLELARKLTADFPTVALVNSVNPYRIEGQKTAAFEI
VDVLGTAPDIHALPVGNAGNITAYWKGYSEYHRDGLSDRLPRMLGTQAAGAAPLVTGEPV
KNPETIATAIRIGAPASWASAVEAQQQSDGRFLAATDEEILAAYHLVARTEGVFVEPASA
ASIAGLLKSVEDGWVAKGSTVVCTVTGNGLKDPDTALKGMPTVTPLAVDPVAVAAELGLV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgagcacgcccgtgaacgcggtgcaccggcgctggccggggctgatcgaggcctaccgc
gaccggcttcccgtcggcgacgactggacgccggtcaccctgctcgagggtggcacgccg
ctgatacacgccaagcggttgagcgaattcaccggctgcacagtgcatctgaaggtcgag
gggctcaacccgaccggttcgttcaaggaccgcgggatgacggtcgcggtcaccgagtcg
gcggccagcggtaagcaggcggtgctgtgcgcatcgacgggcaacacctccgcctcggca
gcggcgtatgcggcccgcgccggcatcacgtgtgcggtgctgatcccgcagggcaagatc
gcgatgggcaagctggcccaggcggtcatgcacggcgccaagatcatccagatcgacggg
aacttcgacgactgcctcgaactcgcccgcaagctgaccgccgacttcccgaccgtcgca
ctggtcaactcggtcaacccctaccgcatcgagggtcagaagaccgccgcgttcgagatc
gtcgacgtcctgggcactgcgcccgacatccacgctctgccggtcggcaacgcgggcaac
atcaccgcgtactggaagggctacagcgagtaccaccgcgacggcctgtccgaccggttg
ccccggatgctgggcacccaggcggcgggggccgcgccgctggtgaccggtgagcccgtg
aagaacccggagacgatcgccaccgcgatccgcatcggcgcccccgcgtcgtgggcgtcg
gcggtcgaagcccagcagcagtcggacggccgcttcctggcggcgaccgacgaggagatc
ctggcggcgtaccacctggtcgcgcgcaccgaaggagtcttcgtcgaaccggcctcggcg
gccagcatcgccgggctgctcaagtccgtcgaggacggttgggtggccaaggggtcgacc
gtggtgtgcaccgtcaccggcaacggactcaaggatcccgacaccgcgctcaagggaatg
cccaccgtcacaccgctcgccgtggatccggtggcggtggcggccgaactcggtctggtc
tga

DBGET integrated database retrieval system