KEGG   Mycobacterium sp. KMS: Mkms_4197Help
Entry
Mkms_4197         CDS       T00442                                 

Definition
(GenBank) fumarase
  KO
K01679  fumarate hydratase, class II [EC:4.2.1.2]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00020  Citrate cycle (TCA cycle)
mkm00620  Pyruvate metabolism
mkm01100  Metabolic pathways
mkm01110  Biosynthesis of secondary metabolites
mkm01120  Microbial metabolism in diverse environments
mkm01130  Biosynthesis of antibiotics
mkm01200  Carbon metabolism
Module
mkm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mkm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mkm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mkms_4197
   00620 Pyruvate metabolism
    Mkms_4197
Enzymes [BR:mkm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.2  fumarate hydratase
     Mkms_4197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lyase_1 FumaraseC_C
Motif
Other DBs
NCBI-ProteinID: ABL93389
UniProt: A1UKN1
Position
4423331..4424752
Genome map
AA seq 473 aa AA seqDB search
MTADSAVDQNTEYRIEHDTMGEVRVPKDALWRAQTQRAVENFPISGRGLERTQIRALGLL
KGACAQVNKDLGLLAPEKADAIIAAAAEIADGRHDDQFPIDVFQTGSGTSSNMNSNEVIA
SIAAANGVTVHPNDDVNMSQSSNDTFPTATHIAATEAAVRHLIPALEVLHESLAGKARQW
RTVVKSGRTHLMDAVPVTLGQEFGGYARQIEAGIERVKATLPRLGELAIGGTAVGTGLNA
PDGFGAKVVEVLVDQTGLGELTTAKDSFEAQAARDGLVEASGALRVIAVSLTKIANDIRW
MGSGPLTGLAEIQLPDLQPGSSIMPGKVNPVLPEAVTQVAAQVVGNDAAVAWGGAAGAFE
LNVYIPMMARNLLESFKLLTNVSRLFAERCIDGLVANEEHMREQAESSPSIVTPLNSAIG
YEEAAKVAKEALKEKKTIRQTVIDRGLIGDKLSEEELDRRLDVLAMAKVKQGK
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgacagcgctgtcgaccagaacaccgagtaccgcatcgaacacgacaccatg
ggcgaggtccgggtgcccaaggatgcgctgtggcgggcgcagacccagcgcgccgtcgag
aacttcccgatctcgggccgcggcctcgagcgcacccagatccgcgcgctgggactgctc
aaaggcgcctgcgcgcaggtgaacaaggatctcggcctgctcgctcccgagaaggcggac
gcgatcatcgccgcggccgccgagatcgccgacgggcgtcacgacgaccagttcccgatc
gacgtgttccagaccggttcgggcaccagttcgaacatgaactccaacgaggtcatcgcc
tcgatcgcggcggcgaacggcgtgaccgtccaccccaacgacgacgtgaacatgtcgcag
agctccaacgacacgttcccgacggccacccacatcgcggcgacggaagccgctgtgcgc
cacctgatcccggcgctcgaggtgctgcacgaatcgctggccggcaaggcgcggcagtgg
cgcacggtcgtgaagtccgggcgcacgcacctgatggacgcggtgccggtgacgctgggc
caggagttcggcggttacgcccgtcagatcgaggccggtatcgagagggtcaaggcgacg
ctgccccggctgggtgagctggccatcggcggtaccgccgtcggcaccgggctcaacgcg
cccgacggcttcggcgccaaggtcgtcgaggtgctcgtcgaccagaccggtctgggcgaa
ttgaccacggccaaggactctttcgaggcgcaggccgcccgcgacgggctggtcgaggcg
tccggtgcgctgcgggtgatcgcggtgtcgctgaccaagatcgccaacgacatccgttgg
atgggttcgggcccgctgaccggcctggccgagatccagctgccggatctgcagccgggc
agctcgatcatgccgggcaaggtgaatcccgttctgcccgaagccgtcacgcaggtcgcc
gcccaggtcgtcggcaacgacgccgccgtcgcatggggtggcgcggccggcgcgttcgag
ctcaacgtgtacatcccgatgatggcgcgcaacctgctcgagtcgttcaagctgctgacc
aacgtgtcgcggctgttcgccgagcggtgcatcgacggcctggtcgccaacgaggagcac
atgcgcgagcaggccgagtcgtcgccgtcgatcgtgacgccgctgaactcggcgatcggc
tacgaggaggcggccaaggtcgccaaggaagcgctcaaggagaagaagacgatccgccag
acggtcatcgaccgcgggctgatcggcgacaagctctccgaggaggaactcgaccgtcgc
ctcgacgtgctggcgatggcgaaggtcaagcagggcaagtag

DBGET integrated database retrieval system