KEGG   Mycobacterium sp. KMS: Mkms_4764Help
Entry
Mkms_4764         CDS       T00442                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00071  Fatty acid degradation
mkm00072  Synthesis and degradation of ketone bodies
mkm00280  Valine, leucine and isoleucine degradation
mkm00310  Lysine degradation
mkm00362  Benzoate degradation
mkm00380  Tryptophan metabolism
mkm00620  Pyruvate metabolism
mkm00630  Glyoxylate and dicarboxylate metabolism
mkm00640  Propanoate metabolism
mkm00650  Butanoate metabolism
mkm00900  Terpenoid backbone biosynthesis
mkm01100  Metabolic pathways
mkm01110  Biosynthesis of secondary metabolites
mkm01120  Microbial metabolism in diverse environments
mkm01130  Biosynthesis of antibiotics
mkm01200  Carbon metabolism
mkm01212  Fatty acid metabolism
mkm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mkm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mkms_4764
   00630 Glyoxylate and dicarboxylate metabolism
    Mkms_4764
   00640 Propanoate metabolism
    Mkms_4764
   00650 Butanoate metabolism
    Mkms_4764
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Mkms_4764
   00072 Synthesis and degradation of ketone bodies
    Mkms_4764
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mkms_4764
   00310 Lysine degradation
    Mkms_4764
   00380 Tryptophan metabolism
    Mkms_4764
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Mkms_4764
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mkms_4764
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Mkms_4764
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mkm04147]
    Mkms_4764
Enzymes [BR:mkm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Mkms_4764
Exosome [BR:mkm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mkms_4764
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C
Motif
Other DBs
NCBI-ProteinID: ABL93954
UniProt: A1UM96
Position
4997080..4998243
Genome map
AA seq 387 aa AA seqDB search
MGNPVIVEATRSPIGKRNGWLSGLHATELLGAVQKALVEKAGIDPGDVEQLIGGCVTQYG
EQSNNITRVSWLTAGLPEHVGATTIDCQCGSAQQANHLVAGLIATGAIDIGIACGIEAMS
RVGLGANAGPDRSKIRAESWDIDMPNQFEAAERIAKRRGITREDIDQLGFASQAKAKQAW
AENRFDREISPIVAPVLDENKQPTSERAPVSKDQGLRDTTLEGLAQLKPVMEGGIHTAGT
SSQISDGAAAVLWMDEDKAKALGLKPRARIVAQANVGAETYYHLDGPVQSTAKVLEKAGM
KLGDIDLVEINEAFASVVLSWAQVHGADMDKVNVNGGAIALGHPVGSTGARLITTALHEL
ERTGKGTALITMCAGGALSTGTIIERI
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaccctgtcatcgtcgaagccacccgcagtccgatcggaaagcgcaacggatgg
ctgtccggactccacgcgaccgaactgttgggtgcggtgcagaaggctctggtcgagaag
gccgggatcgatccgggcgatgtcgagcagctcatcggcggctgcgtcacccagtacggc
gagcagtccaacaacatcacccgcgtgagctggctgaccgcggggttgcccgagcatgtc
ggcgccaccacgatcgactgccagtgcgggagcgcccagcaggccaaccacctggtcgcc
ggcctgatcgccaccggcgccatcgacatcggtatcgcctgcggtatcgaggcgatgagc
cgggtcgggctcggcgcgaacgccggacccgaccgctcgaagatccgcgcggagtcgtgg
gacatcgacatgcccaaccagttcgaggccgccgaacgcatcgccaagcgccgcggtatc
acgcgcgaggacatcgaccagctcggcttcgcgtcacaggccaaggccaagcaggcgtgg
gccgagaaccgcttcgaccgggagatctcgccgatcgtggcgccggtgctcgacgagaac
aagcagccgacctccgagcgcgcaccggtgtccaaggatcagggtctgcgcgacaccacc
ctcgaggggctggcccaactgaagccggtcatggaaggcggaatccacaccgcgggcacc
tcctcgcagatctcggacggcgccgccgcggttctgtggatggatgaggacaaggcgaag
gcgctgggattgaagccgcgtgcccggatcgtggcgcaggccaacgtcggcgcggagacc
tattaccacctcgacggacccgtccagtcgactgccaaggtgctggagaaggccgggatg
aagctcggcgacatcgacttggtcgagatcaacgaggcgttcgcgtcggtggtgttgtcg
tgggcgcaggtacacggcgccgatatggacaaggtcaacgtcaacggcggcgcgatcgcc
ctcggacatccggtgggctccaccggtgcccggttgatcaccaccgcgctgcacgaactc
gaacgcaccggtaagggcaccgcgctgatcacgatgtgcgcgggcggcgccctgtcgacg
ggcaccatcatcgagcggatctga

DBGET integrated database retrieval system