KEGG   Mycobacterium sp. KMS: Mkms_4869Help
Entry
Mkms_4869         CDS       T00442                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00040  Pentose and glucuronate interconversions
mkm00053  Ascorbate and aldarate metabolism
mkm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mkm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mkms_4869
   00053 Ascorbate and aldarate metabolism
    Mkms_4869
Enzymes [BR:mkm01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     Mkms_4869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ABL94059
UniProt: A1UMK1
Position
complement(5096999..5098591)
Genome map
AA seq 530 aa AA seqDB search
MTPASQTELTGQMLIAGAAVRGVGPEIRGFDPTAGTELGPGYRYGDASHVDAACAAAAAA
FGPYRSTPAEARARLLEAIADGLVAITDDLVARAHAESGLPRARLTGELGRTAGQLRLFA
AVLREGSWNGVRIDTAQPDRTPLPRPDLRQRAVPLGPVAVFGASNFPLAFSVAGGDTASA
LAAGCPVVVKAHDAHPGTSELVGRVITDAVAAAGLPPGTFSLLNLAQEGGITLVTDPRVK
AVGFTGSRAGGLALVDAAARRREPIPVYAEMSAVNPVFLLDGALAAGGADLGRAFVDSLT
LGSGQFCTNPGLIVAVDGPGLDTFVDAARDALAGSAPTAMLTPGIAENYRAGVEALAGRA
TLIARGSADGTAAVSCRAALFGTDAVSLLGSVSLQAEVFGASSLIVRCADFEEMTTVAAN
VEGQLTATLHADESDHDRAAALLPILELKAGRILFNGWPTGVEVTHAMVHGGPFPATSDS
RTTSVGSRAIERFLRPVCYQNAPGVLLPAAVADGNPECLWRRVDGELTRD
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgacaccggcgtcccagactgaactgaccggccagatgctcatcgccggtgcggcagtg
cgtggcgtcgggcccgagatccgcggcttcgatccgaccgcgggcaccgaactcggaccc
ggctaccgctacggggacgcctcgcatgtcgacgcggcgtgcgctgccgcggccgcggcg
ttcgggccgtaccgcagcacgcccgccgaagcgcgggcccggctcctcgaggcgatcgcc
gacggtctcgtcgcgatcaccgacgacctcgtcgcccgtgcacacgccgaatccggcctc
ccgcgagcgcggctgaccggcgaactcggtcgcaccgcgggacagctgcggctcttcgcc
gccgtgctgcgtgagggcagctggaacggcgtgcgcatcgacaccgcccaacccgaccgc
accccgctgccccgtccggacctccgccagcgcgccgtaccgctggggccggtcgccgtc
ttcggggcgagcaacttcccgctggccttctcggtcgccggcggcgacacggcgtccgcg
ctggcggcgggctgcccggtcgtcgtcaaggcgcacgacgcgcacccgggcacctccgaa
ctggtcggccgggtgatcaccgacgcggtcgccgcggccggcctgccgcccggcaccttc
tcgctgctcaatctcgcgcaggaaggcggcatcaccctggtcaccgatccacgtgtcaag
gcggtggggttcaccggttcacgggccggcgggctggcgctcgtcgacgccgcggcgcgc
cggagggaaccgatccccgtctacgcggagatgagcgcggtcaacccggtgttcctgctc
gacggcgcgctcgccgccggcggagccgacctggggcgggcgttcgtcgattcgctcacg
ctggggtcgggtcagttctgcaccaatcctggcctgatcgtcgcggtggacggacccggc
ctcgacaccttcgtcgacgccgcgcgcgatgcgctggccggatcggccccgacggcgatg
ctgaccccggggatcgcggagaactaccgcgccggtgtcgaggcgctggccgggcgggcg
acgctgatcgcccgcgggtcggccgacggcacggcggcggtgtcgtgccgggcggcgttg
ttcggcaccgacgcggtcagcctgctcgggtcggtgtcgctgcaggcggaggtcttcgga
gcgtcgagcctgatcgtgcgttgcgccgacttcgaggagatgacgacggtcgccgccaac
gtggagggacagctgacggccaccctgcacgcggacgaatccgaccacgaccgggccgct
gcactgctgccgatcctcgaactgaaagcgggccggatcctgttcaacggttggccgacc
ggcgtcgaggtcacccatgcgatggtgcacggtggaccgttcccggccacttcggattcg
cgcaccacatcggtcggatcccgggcgatcgaacggtttctgcgccctgtctgctaccag
aacgcaccgggggtgctgctgcccgcggcggtggccgacggcaatcccgagtgcctgtgg
cgacgggtcgacggggaactcaccagagactga

DBGET integrated database retrieval system