KEGG   Mycobacterium sp. KMS: Mkms_4895Help
Entry
Mkms_4895         CDS       T00442                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mkm  Mycobacterium sp. KMS
Pathway
mkm00010  Glycolysis / Gluconeogenesis
mkm00620  Pyruvate metabolism
mkm00640  Propanoate metabolism
mkm00680  Methane metabolism
mkm01100  Metabolic pathways
mkm01110  Biosynthesis of secondary metabolites
mkm01120  Microbial metabolism in diverse environments
mkm01130  Biosynthesis of antibiotics
mkm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mkm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mkms_4895
   00620 Pyruvate metabolism
    Mkms_4895
   00640 Propanoate metabolism
    Mkms_4895
  Energy metabolism
   00680 Methane metabolism
    Mkms_4895
Enzymes [BR:mkm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mkms_4895
Lipid biosynthesis proteins [BR:mkm01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mkms_4895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABL94085
UniProt: A1UMM7
Position
5131143..5133125
Genome map
AA seq 660 aa AA seqDB search
MTTLTPMSDVHTEVPSSYPPPAEFAEQANAKAEMYREAEEDRLAFWAKQAERLSWDTPFT
EVLDWSDAPFAKWFVGGKINVAYNCVDRHVEAGNGDRVAIHWEGEPVGDSRSLTYAELKD
EVCKAANALTDLGLTAGDRAAIYMPMVPEAIVAMLACARLGVLHSVVFAGFSASALKARI
EDAEAKLVITTDGQYRRGKAASLKDAVDEAVDGQPSIEHVLVVRRTGIDVKWTDGRDLWW
HETVDGASTEHTPEAFDSEHPLFLLYTSGTTGKPKGIVHTTGGYLVQSSYTHHNVFDVKP
DTDVYWCTADIGWVTGHTYITYGPLSNGVTQVVYEGTPTSPSEHRHFEVIEKYGVTIYYT
APTLVRTFMKLGRAVPDAHDLSSLRLLGSVGEPINPEAWRWYRNVFGDNNIPVVDTWWQT
ETGAIMISPLPGVTAAKPGSAMTPLPGISAKIVDDDGNQLPPGSDHGEQANGYLVLDQPW
PAMLRGIWGDPQRFKETYWSRFAEQGWYFAGDGARYDADGNIWVLGRIDDVMNISGHRIS
TAEVESALVGHSHVAEAAVVGATDDHTGQAICAFVILESSAADKPHEHMVEELRAEVAKE
ISPIARPREIHVVPELPKTRSGKIMRRLLRDVAEGRELGDTSTLVDPGVFEAIRASKAEV
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
gtgactacgctcacacccatgtccgacgtgcacaccgaagtcccgtccagctacccgccg
cccgccgaattcgccgagcaggcgaacgccaaagcggagatgtatcgagaagccgaggag
gaccggctcgccttctgggccaagcaggccgagcgattgtcgtgggacaccccgttcacc
gaggtgctggactggtcggacgccccgttcgcgaagtggttcgtcggcggcaagatcaac
gtggcctacaactgcgtcgaccgccacgtcgaggccggcaacggtgaccgcgtggcgatc
cactgggagggcgaaccggtcggcgactcccgctcactgacctacgccgaactcaaagac
gaagtgtgcaaggcggccaacgcgctgaccgacctcggtctgaccgccggcgaccgggcc
gcgatctacatgccgatggtgcccgaggcgatcgtggcgatgctggcgtgtgcgcgcctt
ggcgtcctgcactcggtggtgttcgccgggttctcggcgtcggcgctcaaggcccgcatc
gaggacgccgaagccaaactcgtcatcaccaccgacgggcagtaccggcgcggtaaggcc
gcctcgttgaaggacgcggtcgacgaggccgtcgacggtcaaccctcgatcgagcacgtt
ctggtggtgcgccgcaccgggatcgacgtcaagtggaccgacggacgcgacctgtggtgg
cacgagacggtcgacggcgcgtccaccgagcacacccccgaggccttcgactccgagcat
ccgctgttcctgctctacacctcgggcacgacggggaagcccaagggaatcgtgcacacg
accggcggctacctcgtgcagtcgtcgtacacccaccacaacgtgttcgacgtcaaaccc
gacaccgacgtgtactggtgcaccgcggacatcggctgggtcaccggccacacctacatc
acctacggcccgctgtcgaacggtgtcacccaggtggtctacgagggcaccccgacctca
ccgagcgagcaccgccatttcgaggtcatcgagaagtacggcgtcaccatctactacacc
gcgccgacgctggtccgcacgttcatgaagctcggccgcgcggtccccgacgcccacgat
ctgtcgagtctgcggctgctcggttcggtcggagagccgatcaaccccgaggcgtggcgt
tggtaccggaatgtgttcggcgacaacaatatcccggtcgtcgacacctggtggcagacc
gagaccggcgcgatcatgatctccccgctcccgggtgtcacggcggccaaacccggttcg
gcgatgaccccgttgcccggcatctcggccaagatcgtcgacgacgacggcaaccaactc
ccgcccggcagcgaccacggtgagcaggccaacgggtacctggtactcgaccagccctgg
ccggcgatgctgcgcggcatctggggcgatccgcagcgcttcaaggagacctactggtcc
cgattcgccgagcagggttggtacttcgccggtgacggcgcgcgttacgacgccgacggc
aacatctgggtgctgggccgcatcgacgatgtgatgaacatatccggccaccggatctcc
accgcggaggtggagtcggcgctcgtgggtcactcacacgtcgccgaggccgccgtcgtg
ggcgccaccgacgaccacaccggtcaggcgatctgcgcgttcgtcatcctcgagtcctcc
gcggccgacaagccgcacgagcacatggtcgaggagttgcgcgccgaagtggccaaggag
atctccccgatcgcccgcccgcgcgagatccacgtggtgcccgaactccccaagacccgc
agcggcaagatcatgcgacgactgctgcgcgacgtcgccgaaggccgcgaactcggcgac
acctcgacgctcgtcgaccccggcgtgttcgaggcgatccgcgccagcaaggccgaggtt
tag

DBGET integrated database retrieval system