KEGG   Mycobacterium kansasii ATCC 12478: MKAN_06115Help
Entry
MKAN_06115        CDS       T02887                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mkn  Mycobacterium kansasii ATCC 12478
Pathway
mkn00071  Fatty acid degradation
mkn00072  Synthesis and degradation of ketone bodies
mkn00280  Valine, leucine and isoleucine degradation
mkn00310  Lysine degradation
mkn00362  Benzoate degradation
mkn00380  Tryptophan metabolism
mkn00620  Pyruvate metabolism
mkn00630  Glyoxylate and dicarboxylate metabolism
mkn00640  Propanoate metabolism
mkn00650  Butanoate metabolism
mkn00900  Terpenoid backbone biosynthesis
mkn01100  Metabolic pathways
mkn01110  Biosynthesis of secondary metabolites
mkn01120  Microbial metabolism in diverse environments
mkn01130  Biosynthesis of antibiotics
mkn01200  Carbon metabolism
mkn01212  Fatty acid metabolism
mkn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mkn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MKAN_06115
   00630 Glyoxylate and dicarboxylate metabolism
    MKAN_06115
   00640 Propanoate metabolism
    MKAN_06115
   00650 Butanoate metabolism
    MKAN_06115
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MKAN_06115
   00072 Synthesis and degradation of ketone bodies
    MKAN_06115
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MKAN_06115
   00310 Lysine degradation
    MKAN_06115
   00380 Tryptophan metabolism
    MKAN_06115
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MKAN_06115
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MKAN_06115
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MKAN_06115
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mkn04147]
    MKAN_06115
Enzymes [BR:mkn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MKAN_06115
Exosome [BR:mkn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MKAN_06115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AGZ49896
UniProt: U5WPQ1
Position
complement(1374494..1375705)
Genome map
AA seq 403 aa AA seqDB search
MSDAFICEPVRTPIGRYGGMFKSLSAVDLGVAALNGLMDRTGLPPEAVQDVILGHCYPSS
EAPAIGRVVALDAGLPVTVPGMQVDRRCGSGLQAVIHACLQVSNGDNDLVIAGGCESMSN
VAFYSTDMRWGGARGGIRVHDGLARGRTTAGGRHHPVAGGMLETAENLRRRYGISRLEQD
ELAVTSHRRAVTAQQDGFLAAEIIPVAVPTRHGEQLIGTDEHPRADTTLESLGKLKPVLL
NQDPQATVTAGNASGQNDAASMCVVTTPAKAAEYGLRPLVRLVSWGLAGVAPDIMGIGPV
PATEAALAKAGLRLADIDLIELNEAFAAQALAVMREWNFGAVDRERTNVHGSGISLGHPV
GATGGRMLATLARELDRRQARYGLQTMCIGGGQGLAAVFERVA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgccttcatctgcgagccggtccgcacgccgattggccgctacggcggaatg
ttcaagtcactgagcgccgttgacctcggcgtcgccgcgctcaacggactgatggaccgc
accggcttgccgcccgaggcggtgcaggacgtgattctggggcactgctatcccagcagc
gaggcaccggccatcggccgcgtggtcgcgctggatgccggcctgccggtcacggttccc
gggatgcaggtcgaccgccgctgcggctcgggtctgcaggccgtgatccacgcctgcctg
caggtgagcaatggcgacaacgacctcgtcatcgccggcggctgcgaaagcatgagcaat
gtcgcgttctattccaccgatatgcgctggggtggtgcccgcggtggcatccgggtgcac
gacggcctggcccgtggccgcaccacggccgggggccggcatcatccggtggccggcgga
atgctggagaccgccgaaaatctgcgccgccggtacggcatttcgcggctggagcaagat
gaactcgcggtgacgtcgcatcggcgtgcggtcaccgcgcaacaggacggcttcctggcc
gcggagatcattccggtcgcagtgcccacccgccacggcgagcagttgatcggcaccgac
gaacatccccgcgccgacacgacgcttgagtcgctgggcaagctcaaacccgttctgctg
aaccaagatccgcaggccacggtgacagccggcaacgccagcggccaaaacgatgcggca
tcgatgtgcgtggtcaccacgccggccaaagccgccgagtacggcttgaggccgttggtc
cgtttggtgtcctgggggctggcgggggtggctcccgacatcatgggcatcggcccggtg
cccgcgaccgaggccgcactcgccaaggcgggcctgcggctggccgacatcgatctcatc
gaactcaacgaagcgttcgccgcgcaggcgcttgcggtgatgcgggagtggaacttcggt
gccgtcgaccgggaacgcaccaacgtgcacggctccggcatctcgttgggtcatcccgtc
ggcgcgaccggcggcaggatgctggccaccttggcacgtgaactggatcggcgccaggcg
cgctacggcctgcaaaccatgtgcatcggcgggggtcaggggctggccgccgtctttgaa
cgggtcgcatag

DBGET integrated database retrieval system