KEGG   Mycobacterium kansasii ATCC 12478: MKAN_08560Help
Entry
MKAN_08560        CDS       T02887                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mkn  Mycobacterium kansasii ATCC 12478
Pathway
mkn00450  Selenocompound metabolism
mkn00970  Aminoacyl-tRNA biosynthesis
mkn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mkn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MKAN_08560
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MKAN_08560
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mkn01007]
    MKAN_08560
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mkn03016]
    MKAN_08560
Enzymes [BR:mkn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     MKAN_08560
Amino acid related enzymes [BR:mkn01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   MKAN_08560
Transfer RNA biogenesis [BR:mkn03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MKAN_08560
 Prokaryotic type
   Other AARSs
    MKAN_08560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AGZ50324
UniProt: U5WMC4
Position
1934226..1935788
Genome map
AA seq 520 aa AA seqDB search
MKPLQPYYVTTAIAYPNAAPHVGHAYEYIATDAIARFKRLDGFDVRFLTGTDEHGLKVAQ
AAAAAGVPTAQLARRNSDVFQRMQEALNISFDRFIRTTDPDHYAASQEIWRRMEAAGDLY
LDNYSGWYSVRDERFFVESETQLVDGTRIAIETGTPVTWTEEQTYFFRLSAYADKLLAHY
HAHPDFIAPEVRRNEVISFVSGGLKDLSVSRTSFNWGVPVPEHPDHVMYVWVDALTNYLT
GAGYPDTGSESFRRYWPADLHMIGKDIIRFHAVYWPAFLMSAGIELPRKVFAHGFLHNRG
EKMSKSVGNVIDPVALIQAYGVDQVRYFLLREVPFGQDGSYSDEAIVTRINTDLANELGN
LAQRSLSMVAKNLGGVVPEPGEFCDADTELLATADGLLDRVRAHFDRQAMHLALEAIWLM
LGDANKYFSTQQPWVLRKSESEADQARFRTTLYTTCEVVRIAALLVQPVMPESAAKMLDL
LGQPDDRRAFSAVGTRLAPGTQLPPPTGVFPRYQPPSEVE
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgaagccattgcagccctattacgtcaccaccgcgatcgcgtatcccaacgctgcgccg
catgtgggtcacgcatacgaatacatcgccaccgacgcaatcgcccggttcaagcgactc
gacggcttcgacgtgcgcttcctgaccggtaccgacgaacacggcctgaaggtggcgcag
gccgccgcggccgcgggcgtgccgaccgcacagcttgcccggcgcaattccgacgtcttc
cagcgcatgcaggaggcgctgaacatctccttcgaccggttcatccgcaccaccgacccc
gaccactacgcggcgtcgcaggagatctggcgccggatggaggccgccggtgatctctac
ctggacaactactccggctggtactcggtgcgcgacgagcggtttttcgtcgagtcggag
acccaactcgtcgacggcacccggatcgccatcgagaccggcaccccggtgacctggacc
gaggagcagacctacttcttccggctgtcggcctacgccgacaagctgctggcccactac
cacgcccaccccgacttcatcgcacccgaggtacggcgtaacgaggtgatcagcttcgtg
tccggcggcctcaaagacctgtcggtgtcgcggacgtcgttcaactggggcgtgcctgtg
ccggagcatccggaccacgtcatgtacgtctgggtggacgcgttgaccaactacctgacc
ggcgccggctacccggataccggctcggagtcgttccgccgctactggcccgccgacctg
cacatgatcggcaaggacatcatcaggttccacgccgtctactggccggccttcctgatg
tcggcgggcatcgagttaccgcgaaaggtgttcgcccacgggttcttacacaatcgcggc
gagaagatgagcaagtcggtgggcaacgttatcgacccggtggcactgatccaggcatac
ggcgtggatcaggtccgctacttcctgttgcgggaggtgccgttcgggcaggacggcagt
tacagcgacgaggccatcgtcacccggatcaacaccgatctggccaatgagctcggcaac
ttggcccagcgctcgttgtcgatggttgccaagaacctgggcggggtggtgcccgaaccc
ggggagttctgtgatgccgacaccgagttgctggcgacggctgacgggttgttggatcgg
gtgcgggcccacttcgaccgtcaggcaatgcatctggcgctggaggcgatctggctgatg
ctcggcgacgccaacaagtacttttcgacacagcagccgtgggtgctgcgcaagagcgag
tccgaggccgaccaggcgaggtttcgcaccacgctctacaccacctgcgaggtggttcgc
atcgcagcgctattggtgcagcccgtcatgccggagtccgctgccaagatgctggacctg
ctcggccaacccgacgaccggcgggcgttcagcgcagtgggcacccggctcgcgccgggg
acccaactgccgccgcccacaggggttttcccgcgttaccagccgccttccgaagtcgag
tga

DBGET integrated database retrieval system