KEGG   Mycobacterium kansasii ATCC 12478: MKAN_19275Help
Entry
MKAN_19275        CDS       T02887                                 

Definition
(GenBank) exodeoxyribonuclease V subunit beta
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
mkn  Mycobacterium kansasii ATCC 12478
Pathway
mkn03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mkn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    MKAN_19275
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mkn03400]
    MKAN_19275
Enzymes [BR:mkn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MKAN_19275
DNA repair and recombination proteins [BR:mkn03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     MKAN_19275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase AAA_19 UvrD_C AAA_30 UvrD_C_2 PDDEXK_1
Motif
Other DBs
NCBI-ProteinID: AGZ52193
UniProt: U5WSJ8
Position
complement(4227284..4230553)
Genome map
AA seq 1089 aa AA seqDB search
MERFDLLGPLPAHGATIVLEASAGTGKTFALAGLVTRYLAETDVTLDEMLLITFNRAASR
ELRERVRDQIVAAVAALDGRMPTDTDLVRHLLGSEAERAVRLARLRDALANFDAATIATT
HEFCGSVLRSLGVAGDSDSGFTLRESLDDLVAEIVDDRYLARFANTDTDPALTYAQALDL
ARNVVGDPYAQRRPLDPDPDSAAGVRLDFAEQVLDELERRKRRLRILGYDDLLLRLSKAL
AAADSPARDRMRRRWRIVLVDEFQDTDPIQWQVLERAFRGVSTLIMIGDPKQAIYGFRGG
DIYTYLKAARTADARYTFGVNWRSDRVLVESLQTVLRGAALGHPEIVVHDIEAHHGGHRL
QGAPRGAPFRLRVVRRPTVGYDGTANVPIGVLREHIPADLAGDIASLLSSGARFAERPVA
AGDIAVIVEHHRDARACRDALARAGIPAVYTGDTDVFASRAAKDWLCLLEAFDAPQRSGL
VRAAACTMFFGETVETLAAEGDALTDRVAATLREWTDQARLRGVAAVFEAAQLAGMGRRV
LGQRGGERHMTDLAHLAQLLHETAHRQRYGLPALRDWLRRQCDDTTRAAEQNRRLDSDAA
AVQIMTVFVAKGLQFPIVYVPFLFNRNVRREDIMLYHDDTDTRCLYLGGDNSRSVEELNR
AEAARDNIRLTYVALTRAQSQVVAWWAPTIDEVNGGLSRLLRGRGSGDPLVPDKCAPRIR
DDDAWAVFTRWQEAGGPSVEESTIVSPAAIETASSADGFAVRHFHRQIDTTWRRTSYSAL
VRAADAIVTSGVTSEPEVDVRDDEVDAVVVSEPGSGADLDSPLAAMPSGAAFGSLVHAVL
ETADPQAADLAGELEEQVRRHAPWWPVDTDAAELATALVPMHDSPLGLLAGDLTLRQIGV
RDRLRELDFEIPLAGGDLRARAPRVSLSDVGELLRVHLPRSDPFWSYADRLTSPGLGGQS
LRGYLSGSIDVVLRLPQQRYLVVDYKTNHLGATAADYSVDRLTEAMLHSDYPLQALLYVV
VLHRFLRWRQPGYDPRRHLGGVLYLFVRGMCGAGTPIRDGHPAGVFGWRAPADLVVALSD
LLDDGRRAA
NT seq 3270 nt NT seq  +upstreamnt  +downstreamnt
atggaacgcttcgacctgctggggccgctgcccgcccatggcgccaccattgtgctggag
gccagcgcgggcaccggcaagacgttcgcgctggccggtctggtgacccgctacctcgcc
gagaccgacgtcaccctcgacgagatgctgctgatcacgttcaaccgcgcggccagccgc
gagcttcgcgaacgcgtccgcgaccagatcgtggcggcggtggccgctctagacggccgg
atgccaaccgacactgatctggtcaggcacctgctgggtagcgaggccgagcgggccgta
cggctggctcggctgcgtgacgcgctggccaacttcgatgccgccaccatcgccaccacg
cacgagttctgcggctcggtgctgagatcccttggtgtggcgggtgacagcgattccggc
ttcaccttgcgggagagcctcgacgatctggtggccgagatcgtcgacgaccgctacctc
gcgcgcttcgccaacaccgacaccgatccggcgctgacatacgcgcaggcgctcgacctg
gcccgcaacgtcgtcggcgatccgtacgcgcagcggcgcccgctggatcccgacccggac
agcgcggccggtgtccggttggacttcgccgagcaggtgctcgacgagctcgaacggcgt
aagcgccggctacggattctcggctacgacgacctgctgctgcggttgtcgaaagccctt
gcggcagcggactcgccggctcgtgaccggatgcggcgccggtggcgaatcgtgttggtg
gacgaattccaggacaccgatccgatccagtggcaggtgctggaacgtgctttccggggc
gtgtcgacgctgataatgatcggcgacccgaagcaggctatttacggctttcgcggcggc
gacatctacacctacctcaaggcggcccgcaccgccgacgcccgctacacgttcggagtc
aactggcgcagtgacagggtgctcgtcgagagcctgcagacggtgctgcggggtgccgcg
ctgggtcatccggagatcgtggtgcacgacatcgaggcgcaccacggcgggcatcggctg
cagggggcgccgcgcggcgcgccgtttcggctgcgggtcgtcaggcggccgaccgtcggc
tacgacggtaccgccaatgtgccaatcggcgtgttgcgcgagcatattcccgccgacctg
gccggggacatcgcgtccctgctgtccagcggcgcccggttcgccgaacgaccggtggcg
gccggggacatcgcggtgatcgtcgaacatcaccgagacgcccgggcctgtcgggacgcc
ttggccagggcgggtatcccggcggtctacaccggcgacaccgatgtgttcgcgtcgcgg
gcggccaaagactggctgtgcctgctggaggccttcgacgcaccgcaacgcagcgggctg
gtccgcgccgccgcctgcaccatgtttttcggcgagaccgtggaaacgcttgccgccgaa
ggggatgcgctgaccgaccgggtggccgcgacgctgcgtgagtggacggaccaggcccgg
ctgcggggtgtggcggcggtgttcgaggccgcgcagctggccggcatgggccgccgggtg
ttgggccagcgtggcggcgagcgacacatgaccgacctggcgcatctcgctcagctgttg
cacgagacggcgcatcggcagcgctatggccttccggcccttcgtgattggctgcgccgg
cagtgcgacgacaccacccgcgccgccgagcagaaccggcgattggacagcgacgccgca
gcggtgcagatcatgacggtgttcgtggccaagggtctgcagtttccgatcgtgtacgtg
ccgttcctgttcaacaggaatgtccggcgcgaagacatcatgttgtatcacgacgacacc
gatacccgatgcctctatctcggcggcgacaacagccgatcggttgaggagttgaaccgc
gccgaggcggcccgcgacaacatccggctcacctatgtcgcgctcacccgggcccagtcc
caggtggtggcctggtgggcgccgaccatcgacgaagtcaacggcgggctgtcgcgttta
ctgcgcggtcgtggcagcggtgacccgctggtgccggacaagtgcgcaccgcggatccgc
gacgacgacgcatgggcggtgttcacgcgctggcaggaagccggcggaccgtcggtcgag
gaatcgacgatcgtctcccccgccgccatcgaaacagcttcttcggctgacggtttcgcg
gtccggcactttcatcgccagatcgacaccacgtggcggcgcacgtcgtattcggcgctg
gtgcgcgccgcagatgcgattgtgacgtccggagtgaccagcgaacccgaggtcgacgtg
cgcgatgacgaggtggatgcggtggtcgtcagcgaaccgggttcaggtgccgacctcgac
tcgccgctggccgccatgccgtccggtgcggcgttcgggtcgctggtgcatgcggtgctg
gaaacggccgacccgcaggccgccgacttggctggcgagctcgaggagcaggtgcgacgg
cacgcgccgtggtggccggtcgacaccgacgccgccgagctggcgacggcgctggtgccg
atgcacgactcgccactgggcctgctggccggcgacttgacattgcgccagatcggggtg
cgggatcggctgcgggagctggacttcgagataccgctggcgggcggtgatctgcgggcc
cgcgcgccgcgggtgtcgttatcggatgtgggtgagctgttgcgggtgcacctgccgcgc
agtgacccgttctggtcctacgccgatcggttgacgtcgcccggtttgggcggtcagtcg
ctgcgggggtatctgtccgggtcgatagatgtggtgttgcggttgccgcagcagcgttac
ctggtggtggactacaagaccaaccacttgggcgccaccgccgccgactacagcgtcgac
cgcttgaccgaggccatgttgcattccgactacccgttgcaggcgctgttgtatgtggtt
gtgctgcacaggtttctgcggtggcggcagcccggatatgatccgcgacggcatctgggc
ggggtgctgtatctgttcgtgcggggaatgtgtggtgccggaacgccgatccgggacggg
catccggccggtgtgttcggctggcgcgcgccggccgacttggtggtcgcgctgtcggat
ctgctggatgacgggagacgtgccgcgtga

DBGET integrated database retrieval system