KEGG   Mycobacterium kansasii ATCC 12478: MKAN_22055Help
Entry
MKAN_22055        CDS       T02887                                 

Definition
(GenBank) monooxygenase
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
mkn  Mycobacterium kansasii ATCC 12478
Pathway
mkn00260  Glycine, serine and threonine metabolism
mkn00330  Arginine and proline metabolism
mkn00340  Histidine metabolism
mkn00350  Tyrosine metabolism
mkn00360  Phenylalanine metabolism
mkn00380  Tryptophan metabolism
mkn01100  Metabolic pathways
mkn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mkn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MKAN_22055
   00330 Arginine and proline metabolism
    MKAN_22055
   00340 Histidine metabolism
    MKAN_22055
   00350 Tyrosine metabolism
    MKAN_22055
   00360 Phenylalanine metabolism
    MKAN_22055
   00380 Tryptophan metabolism
    MKAN_22055
Enzymes [BR:mkn01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     MKAN_22055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Pyr_redox_2 FAD_binding_2 FAD_oxidored Thi4 HI0933_like Pyr_redox_3 Pyr_redox GIDA FAD_binding_3 AlaDh_PNT_C NAD_binding_9 Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AGZ52683
UniProt: U5WTZ1
Position
complement(4842330..4843676)
Genome map
AA seq 448 aa AA seqDB search
MTNPRWIADVVIVGAGFAGLAAARDLAGQGHDVLVFEGRDRVGGRSLTGNVAGLPADMGG
TFVGPTQNQVLALADELRVPTIPTYHDGRNVIHWRGAVRPYRGTIPRLSLAGLLDIARLR
WQFERLARGVPISAPWDAPRAHELDGVSLGQWLRAVRATASSHDLMAIMARVTWGCEPED
VSMLHATRYVRAAGGLDRLLDVENGAQQDRFAGGTQQIADLAAAGLGNRVVLDARVRRID
RHGAGVTVTSDQGQAEAGFVIVAIPPAHRAAIEFDPPLPPQYLELTRHWPQGRLSKAYAA
YSTPFWRANGFSGQALSDNGPVFITFDVSPHDDGPGILMGFVDARAFDSLPTEQRRRDTL
RCFASLFGDQALKPLDYADYRWGSEQFAPGGPTAAVPPGSWTKYGRLLREPVGPIHWAGT
ETADEWTGYLEGAVRSGRRAATEVSALL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaacccacgctggattgccgacgtggtcatagtgggtgccggcttcgctggactg
gcggcagcccgcgacctggccggtcagggtcatgacgtgctggtcttcgaaggccgcgac
cgcgtcggcggccgctccctcaccggcaacgtcgcgggattaccggcggatatgggcggc
acgttcgtcggacccactcaaaaccaggtcctggccctggcggacgagctgcgagttccg
accatcccgacctaccacgacggcaggaacgtgatccactggcggggcgcggtgcgcccg
taccgcggcacgatccccaggctttcgctggccggactgctcgacatcgcgcggttgcgc
tggcaattcgagcgactggcccgcggcgtgccgatatccgcgccctgggatgcgccacga
gcgcacgaactcgacggcgtgtcactgggtcagtggttgcgcgcggtgcgcgccaccgcg
tcgtcacacgacctgatggccatcatggcccgggtgacctggggttgcgaacccgaagac
gtgtccatgctgcacgccacccgttatgtacgcgcggcgggcggcctggaccggctcctg
gatgtcgaaaacggcgcccagcaggatcggttcgcgggcggcacgcagcagatcgccgac
ctggcggcggctgggctgggaaaccgggtggtgctggatgcccgggtgcgtcggatcgac
cgccacggcgcgggtgtgaccgtcacgtcggatcagggacaggccgaagccgggttcgtc
atcgtggcgatcccgcccgcacaccgtgcggccatcgagttcgatcccccgctgccgccg
caatacctggaactcacccggcattggccgcagggccggttgagcaaggcctatgccgcg
tattccacaccgttctggcgagccaacggattctccggccaggccttgtccgacaacggc
ccggtgttcatcaccttcgatgtcagcccacatgacgacgggccgggcatcctcatgggt
ttcgtcgatgcccgcgcattcgactccctgcccaccgagcagcgccgccgcgacacgctg
cggtgtttcgcctcgctgttcggcgaccaagcgctcaagccgctcgactacgccgattac
cgttggggcagcgagcaattcgcgccgggcggtcccaccgccgcggtgccgcccggttcc
tggaccaaatacggacggttgctgcgcgaaccggtcgggccgattcactgggccggcacg
gaaaccgcggatgaatggaccggttatttggagggcgccgtcaggtccggtcggcgtgcg
gctaccgaagtctccgcactgctatga

DBGET integrated database retrieval system