KEGG   Mycobacterium kansasii ATCC 12478: MKAN_26280Help
Entry
MKAN_26280        CDS       T02887                                 

Definition
(GenBank) aldolase
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mkn  Mycobacterium kansasii ATCC 12478
Pathway
mkn00051  Fructose and mannose metabolism
mkn01100  Metabolic pathways
mkn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mkn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MKAN_26280
Enzymes [BR:mkn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     MKAN_26280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II
Motif
Other DBs
NCBI-ProteinID: AGZ53421
UniProt: U5WZT4
Position
5770132..5770917
Genome map
AA seq 261 aa AA seqDB search
MATTFSDSKPELMRRAQERLSAETAESPLTTRQKVALTCRALFDAGHDSGLTGQITARAE
DPGTYYTQRLGLGFDEITEDNLLLVDEDLNVLQGDGMANPANRFHSWIYRARPDVQCIVH
THAFHVAALSMLKVPLVVSHMDTTPLYDDCAFLADWPGVPVGNEEGEIITAALGSKKAVL
LAHHGQVVAGASIEEACSLAVLIERAAKLQLAAMAAGTIVELPEQLAREAHDWTLTPARS
RANFGYYARRALARHPDALST
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccacgttttccgattccaagcccgaactgatgcgccgtgcccaggagcggctc
agcgccgagacggccgaatctccgttgacgacccggcagaaggtggcgctgacctgccgc
gccttgttcgacgccggacatgactccggcctgaccgggcagatcaccgcccgcgccgaa
gaccccgggacgtactacacccagcggctgggcctggggttcgacgagatcaccgaagac
aacctgctgctggtcgacgaggacctcaacgtcctgcagggagacggtatggccaacccc
gccaaccgttttcacagctggatctatcgggcacgtcccgatgtgcagtgcatcgtgcac
acccacgccttccacgtggcggcgttgtcgatgctgaaggttccgctggtcgtgtcgcac
atggacaccacgccgctctacgacgactgcgcgtttctcgccgactggccgggcgttccc
gttggcaacgaggagggcgaaatcatcaccgccgcactgggttccaagaaggcggtgctg
ctggcccatcacgggcaggtggtggccggggccagcattgaggaggcgtgctcgctggcg
gtgctgatcgagcgtgccgccaaattgcagctggccgccatggccgccggaaccatcgtc
gagctgcccgagcagctggcccgagaagcccacgactggacgctgacaccggcgcgcagc
cgggctaacttcggctactatgcccgccgcgccctggcgcgccatcccgatgcactgagt
acctaa

DBGET integrated database retrieval system