KEGG   Mycobacterium kansasii ATCC 12478: MKAN_27775Help
Entry
MKAN_27775        CDS       T02887                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
mkn  Mycobacterium kansasii ATCC 12478
Pathway
mkn00780  Biotin metabolism
mkn01100  Metabolic pathways
Module
mkn_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:mkn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    MKAN_27775
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mkn01007]
    MKAN_27775
Enzymes [BR:mkn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     MKAN_27775
Amino acid related enzymes [BR:mkn01007]
 Aminotransferase (transaminase)
  Class II
   MKAN_27775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Cys_Met_Meta_PP Aminotran_3 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AGZ53678
UniProt: U5WWS6
Position
6122836..6123996
Genome map
AA seq 386 aa AA seqDB search
MNAFPRAPIETSPLAWLDEVERQRRAAGLRRSLRPRPAVATELDLASNDYLGLSQHPDVI
DGGVQALRVWGAGATGSRLVTGDTELHQEFEAELAEYVGASSGLLFSSGYTANLGAVVGL
TGPGSLLVSDAYSHASLVDACRLSRARVVVTPHRDLDAVEAALGSRSERRAVVVTDSVFS
ADGTLAPIRELHEVCRRHRALLVVDEAHGLGVRGGGRGLLHEVGLAGAPDVVMTTTLSKA
LGSQGGVVLGPAAVRAHLIDAARPFIFDTGLAPAAVGAAGAALRVLKAEPWRPDAVLTHA
RRLAGICGVPAPPESAVVSVVLGDPEVAVATAAACLDAGVKVGCFRPPTVPAGTSRLRLT
ARASLSADEQELARRVLTDALAVARG
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaacgccttcccgcgggcaccgatcgagacgtcaccgctggcgtggctcgacgaggtc
gagcggcagcgccgcgcggccgggttgcggcgctcgctgcggccacgtcccgccgtcgcc
accgaactggacctggcatccaacgactacctcggcctgtcccagcatcccgatgtcatc
gacggcggtgtccaggcgctgcgggtgtggggcgccggtgccaccggttcccgcctggtc
accggcgacaccgagctgcaccaggagttcgaagccgagctcgccgaatacgtcggcgcc
tcttcggggttgttgttctcctccggctacaccgccaacctgggagctgttgttggctta
accggtcccggttcgctgttggtgtccgacgcctactcgcacgcgtccctggtggatgcc
tgccggctttcgcgggcccgagtggtcgtcaccccgcaccgcgacctcgatgcggtggaa
gcggcactgggatcgcgctccgagcggcgcgccgtcgtcgtcaccgactcggtgttcagc
gccgacggcaccctggcgcccatccgcgagctacacgaggtgtgccgtcggcaccgggcg
ctgcttgtggtcgacgaggcgcatggtctgggggtacgcggcggcgggcgcgggctgttg
cacgaagtcgggctggcgggtgcgcctgatgtggtgatgacgacgacgttgtccaaggcg
ctgggcagccagggcggtgtagttctggggccggcagcggtgcgtgctcatctgatcgac
gcggcccggccgttcatcttcgacaccggtctggcaccggcggcggtgggcgcggcgggt
gccgcgctgcgagtgttgaaggctgaaccatggcggcccgacgccgtcctcacacatgcc
cgccgcctggccgggatctgcggtgtgcccgcaccgccggaatcggccgtggtgtccgtg
gtgctgggtgacccggaggtggcggtggcgaccgcggcggcctgcctggacgccggcgtc
aaggtcggctgtttccgccctccgacggtgcccgccgggacgtcgcggttgcggctgacg
gcgcgcgcctcgctgagtgccgacgagcaggagttggctcgccgtgtcttgaccgacgcc
ctggctgtggcgcgcggttga

DBGET integrated database retrieval system