KEGG   Methylomonas koyamae: MKLM6_0080Help
Entry
MKLM6_0080        CDS       T05118                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
mko  Methylomonas koyamae
Pathway
mko00480  Glutathione metabolism
mko00590  Arachidonic acid metabolism
mko01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mko00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    MKLM6_0080
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MKLM6_0080
Enzymes [BR:mko01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     MKLM6_0080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ATG88365
UniProt: A0A291IDJ6
Position
99245..99787
Genome map
AA seq 180 aa AA seqDB search
MKTLVFLLSICAAALPAFGAETCGDLLNFKMARLRSTEQIDFCQAFQGKLVLAVNTASNC
GYTPQFKGLEALYQKYKNRGLAVIGFPSNDFNQEFDDAEQTAKVCYINYGVTFPMLEKSA
VTGANANAFFRKLAKASGQEPQWNFHKYLIGRNGELISAFPSNATPEQLDAKIGELLSGH
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactttggtgttcttgttgagtatctgcgccgccgcgttgccggcattcggcgcc
gaaacttgcggcgatttgttgaactttaaaatggcccgcttgcgttcgaccgagcaaatc
gacttttgccaggccttccaaggcaagctggtgctcgcggtcaatactgccagcaattgc
ggctacactccccaatttaaaggcctggaagccttgtaccaaaaatacaagaaccgcggc
ttggcggtgatcggctttccgtccaacgatttcaaccaggaattcgacgatgccgagcaa
accgcgaaagtgtgttacatcaattacggcgtgaccttcccgatgctggaaaaaagtgcc
gtaaccggagccaatgccaacgcctttttccggaaactggccaaggccagcggccaggag
ccgcaatggaattttcataaatatctgatcggccgcaacggcgaattaatctcggccttt
cccagtaacgccacgccggagcaattggacgccaaaatcggcgaattgctgtccgggcat
tga

DBGET integrated database retrieval system