KEGG   Mycobacterium kansasii 662: LG40_11745Help
Entry
LG40_11745        CDS       T03652                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mks  Mycobacterium kansasii 662
Pathway
mks00071  Fatty acid degradation
mks00072  Synthesis and degradation of ketone bodies
mks00280  Valine, leucine and isoleucine degradation
mks00310  Lysine degradation
mks00362  Benzoate degradation
mks00380  Tryptophan metabolism
mks00620  Pyruvate metabolism
mks00630  Glyoxylate and dicarboxylate metabolism
mks00640  Propanoate metabolism
mks00650  Butanoate metabolism
mks00900  Terpenoid backbone biosynthesis
mks01100  Metabolic pathways
mks01110  Biosynthesis of secondary metabolites
mks01120  Microbial metabolism in diverse environments
mks01130  Biosynthesis of antibiotics
mks01200  Carbon metabolism
mks01212  Fatty acid metabolism
mks02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mks00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LG40_11745
   00630 Glyoxylate and dicarboxylate metabolism
    LG40_11745
   00640 Propanoate metabolism
    LG40_11745
   00650 Butanoate metabolism
    LG40_11745
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LG40_11745
   00072 Synthesis and degradation of ketone bodies
    LG40_11745
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LG40_11745
   00310 Lysine degradation
    LG40_11745
   00380 Tryptophan metabolism
    LG40_11745
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LG40_11745
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LG40_11745
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    LG40_11745
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mks04147]
    LG40_11745
Enzymes [BR:mks01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LG40_11745
Exosome [BR:mks04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LG40_11745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C Phage_lysis
Motif
Other DBs
NCBI-ProteinID: AIR18684
UniProt: X7YM05
Position
2608852..2610012
Genome map
AA seq 386 aa AA seqDB search
MGNPVIVEATRSPIGKRNGWLSGLHATELLGAVQKALVHKAGIDAGDVEQVIGGCVTQFA
EQSNNISRTAWLTVGLPDHVGATTIDCQCGSGQQANHLIAGLISAGAIDVGIACGIEAMS
RVGLGANAGPDRNWRAESWDIDMPNQFEAAERIAKRRGITREDIDVFGFQSQLRAKRAWD
EGRFDREISPIEAPVLDEQKQPTSERHMVTRDQGLRDTTMEGLSQLKPVLEGGIHTAGTS
SQISDGAAAVLWMDEDKAKALGLKPRARIVSQALVGAEPYYHLDGPVQSTAKVLEKAGMK
MGDIDITEINEAFASVVLSWARVHEPDMDRVNVNGGAIALGHPVGCTGSRLITTALHELE
RTDQSTALITMCAGGALSTGTIIERI
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacccggtaatcgtcgaggccacacgcagcccgatcggcaagcgaaatgggtgg
ttgtcaggtctgcacgccaccgagctgctcggagcggtgcagaaggcactggtgcacaag
gccgggatcgatgcgggagacgtcgaacaggtcatcggcggctgcgtgacccaattcgcg
gagcagtccaacaacatcagccgcaccgcgtggttgactgtggggttgcccgaccacgtc
ggcgccaccaccatcgactgccagtgcggcagcgggcagcaggccaatcacctgatcgcc
gggctgatctcggccggcgcgatcgacgtcggcatcgcctgcggaatcgaggcgatgagc
cgggtcggcttaggggccaacgcggggccggaccgcaactggcgggccgagtcgtgggac
atcgacatgcccaaccagttcgaggccgctgagcgaatcgccaagcgccgcggcatcacc
cgcgaggacatcgatgtcttcgggttccagtcgcaattgcgcgccaagcgcgcctgggac
gagggccgtttcgaccgggaaatctcgcccatcgaggcgccggtgctcgacgagcaaaag
caacccaccagcgagcgccatatggtcacccgcgaccagggcctgcgggacaccaccatg
gaggggctgagccagctgaaaccggtgctggaaggcggcattcacaccgcgggcacgtca
tcgcagatctccgacggcgcggccgcagtgttgtggatggacgaagacaaggccaaggca
ctcggcttgaagccgcgcgcccggatcgtcagccaggcgctcgtcggcgcggagccctac
taccacctcgacggtccggtgcagtcgacggcgaaggtgctcgaaaaggccggcatgaag
atgggcgacatcgacatcaccgagatcaacgaggcgttcgcctccgtggtgctgtcctgg
gcgcgggtccacgagccggacatggatcgggtcaacgtcaacggcggtgcgatcgcattg
ggccatccggtggggtgcaccggcagccggctgatcaccaccgcattgcacgagctggag
cgcacggaccaaagcaccgcgctgatcaccatgtgcgccggcggtgccctgtccaccggg
accatcatcgaaagaatctga

DBGET integrated database retrieval system