KEGG   Methanocorpusculum labreanum: Mlab_0133
Entry
Mlab_0133         CDS       T00472                                 
Name
(GenBank) ABC transporter related protein
  KO
K16786  energy-coupling factor transport system ATP-binding protein [EC:7.-.-.-]
Organism
mla  Methanocorpusculum labreanum
Pathway
mla02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mla00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Mlab_0133
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mla02000]
    Mlab_0133
Transporters [BR:mla02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Energy-coupling factor transporter
    Mlab_0133
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_23 AAA_16 AAA_15 SbcC_Walker_B ABC_ATPase AAA_29 Zeta_toxin T2SSE AAA_30 MukB NACHT AAA_27 cobW
Other DBs
NCBI-ProteinID: ABN06310
UniProt: A2SPQ4
Position
119095..119670
AA seq 191 aa
MIEITDLRHGVLSIPSLSIPPGLTVVSGKNGAGKTTLLKICSGIVLPDSGSVSIDGPSPR
LQNVGYVSEFPDRHLLFPIVFEEIASSLRFAKIPQARIEEKVLQTAEDAGITHLLKRECR
TLSGGEKMLVGITAAVIHDPILLVLDEPDSHLDPETVEDLCSFISSRHISYVMWSSHSVS
LRQKADFEVRL
NT seq 576 nt   +upstreamnt  +downstreamnt
ttgattgaaatcaccgatctccgtcacggggttttgagcatcccctctctatcgattccg
cctggacttacggtggtctccggcaaaaacggcgcaggaaaaacaacgctcctgaagatc
tgttcggggatcgttcttcccgattcaggctctgtcagtatagatggcccttcccctcgt
ttgcagaatgtgggttacgtgagcgagtttcccgaccgccatctgctgtttccgatcgtg
ttcgaagagatcgcctcctcccttaggtttgccaaaattccgcaggccaggatcgaggaa
aaagttttacagaccgcagaggatgcaggcataactcatctgctcaaaagggagtgccgg
acactctccggcggtgagaagatgcttgtcgggataacggcggcggtcattcacgatcct
atccttctcgttctcgacgagccggattcccatctagacccggagaccgttgaagatctt
tgctcgtttatttcttcgagacatatttcgtatgtgatgtggagttcgcattccgtttcc
cttagacaaaaagcggatttcgaggtgagactgtga

DBGET integrated database retrieval system