KEGG   Methanocorpusculum labreanum: Mlab_0134
Entry
Mlab_0134         CDS       T00472                                 
Name
(GenBank) ABC transporter related protein
  KO
K16787  energy-coupling factor transport system ATP-binding protein [EC:7.-.-.-]
Organism
mla  Methanocorpusculum labreanum
Pathway
mla02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mla00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Mlab_0134
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mla02000]
    Mlab_0134
Transporters [BR:mla02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Energy-coupling factor transporter
    Mlab_0134
SSDB
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_29 S_100 AAA_23 dNK AAA_18
Other DBs
NCBI-ProteinID: ABN06311
UniProt: A2SPQ5
Position
119667..120230
AA seq 187 aa
MRIVLSSVQLRAGAFSFAADDFFSEGVHMISGRIGSGKSTLGSALAGLSEIESGKIILEG
CGSPILLMQFPEYQVTGPTVVREISSWGVPRGDPTFSSLDVEISDRDPFTLSRGELKRLM
LACVFSKDPDVLILDEPYASLDISAKEVLTGMIENRRGITIVFSHETEYAPNHAVWWKIE
SGGLHRE
NT seq 564 nt   +upstreamnt  +downstreamnt
gtgagaatcgtcctctcttcggtccaactccgtgcaggtgcattttcttttgcggccgac
gatttcttttccgaaggggtccatatgatttccggcaggattgggtcaggaaaatccacg
cttggatcggctctggccggattatccgaaattgaatccgggaaaataattttggaaggc
tgtggttctccaattcttttgatgcagtttccggaatatcaggtgacaggcccgacggtg
gtccgtgagatttcgtcatggggcgtcccccgtggggatccgacattctccagtctcgac
gtggagatatcggatcgggatccgtttacactatccagaggagaactgaaacggctgatg
cttgcctgtgttttttccaaagacccggatgttctcattctcgatgagccgtatgcttcg
ctggatatttcggcgaaggaggttttgaccggtatgattgaaaaccgccggggtatcacg
atcgttttttctcatgaaacggagtatgcgccgaatcacgcagtgtggtggaaaatagag
agcggaggcctgcatcgtgagtga

DBGET integrated database retrieval system