KEGG   Methanocorpusculum labreanum: Mlab_0135
Entry
Mlab_0135         CDS       T00472                                 
Name
(GenBank) hypothetical protein
Organism
mla  Methanocorpusculum labreanum
SSDB
Motif
Pfam: DUF1905
Other DBs
NCBI-ProteinID: ABN06312
UniProt: A2SPQ6
Position
120223..120849
AA seq 208 aa
MSDIRFRLLTLVLLSVLSFVNLFGAAAVFIWWLVFGAKTTFAKNSWKIVVPVSIFIGLFP
SVVLYFTGGDFFYGAKIFVLVLLAFWFSASLLPGELMSFFVWLFGQRIGFDLGMAAEFSV
QAISEIREDFGRMRAALRIKGQKFSVSAVPSLAAGLLILSLRRAGVQSSLLARRGYCSGG
AFVPFFSPGVYDFLMLGTAVCLYGVCLI
NT seq 627 nt   +upstreamnt  +downstreamnt
gtgagtgacatccgcttccggcttcttacgcttgtgcttctctcggtcctttccttcgtg
aatttgtttggagcggcggcggtttttatctggtggctcgttttcggggcaaagacgacg
tttgcaaaaaattcctggaagatcgttgtgccggtatcgatttttatcggtctgtttccc
tcggttgttttgtattttacgggcggtgattttttctacggcgcgaagatctttgttctt
gttctgcttgcgttctggttctcggcttccttgcttccgggcgaactgatgagtttcttt
gtctggctttttggtcagcgtatcggttttgatctggggatggcagcagagttttccgtt
caggcgatcagcgagatcagggaggatttcgggcgtatgcgggctgctcttcgtatcaag
ggtcagaagttttccgtttcggccgtcccttctcttgcggcaggtctgctcattctttcg
ttaaggagagcaggtgtccagtcatcgcttctggcaagacggggatattgttcgggaggg
gcgttcgtcccgtttttttcgccaggggtgtatgattttctgatgcttggcactgctgtt
tgtctgtatggtgtgtgtttgatttga

DBGET integrated database retrieval system