KEGG   Methanocorpusculum labreanum: Mlab_0417Help
Entry
Mlab_0417         CDS       T00472                                 

Definition
(GenBank) DNA topoisomerase (ATP-hydrolyzing)
  KO
K03166  DNA topoisomerase VI subunit A [EC:5.6.2.2]
Organism
mla  Methanocorpusculum labreanum
Brite
KEGG Orthology (KO) [BR:mla00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mla03032]
    Mlab_0417
Enzymes [BR:mla01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.2  DNA topoisomerase (ATP-hydrolysing)
     Mlab_0417
DNA replication proteins [BR:mla03032]
 Prokaryotic Type
  DNA Topoisomerases
   Mlab_0417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP6A_N
Motif
Other DBs
NCBI-ProteinID: ABN06593
UniProt: A2SQI7
Position
397297..398394
Genome map
AA seq 365 aa AA seqDB search
MSDPSERDTATKKRLMEIAKVWYDQIAGGDVPSITLPTRTKYNIEYDDESEVWKYGDKES
VRNAGTAKSATHMLKMAYVIWFIKTQLQENRSSTLREMYYISEGWKQAKFGAQNESNYLI
EDLEIITALQREFFHMRPEEDGASIFGPIRVRENTRRGMKEIHCQDDVGEAGYNIPNNVE
NVELVDHDASCVIAIETGGMFSRLQENGFDEEYNAVLLHLKGQPARATRRMLKRMNEELG
IPVVVFTDGDPWSYRIYASVAYGSIKSAHMSELLATPSAQFIGVKPSDIQRYNLPADKLT
EQDVSALKAELTDPRFATDFWKKEINLQLEMNLKSEQQAFASRGLDFVTKEYLPSMLSEI
GVLKR
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacccaagtgaaagagatacggcaacaaaaaaacgcctgatggaaattgccaaa
gtctggtatgatcaaattgcgggcggcgacgttccttcgatcacactgcctacgagaaca
aagtacaacatcgagtatgatgacgagtccgaggtgtggaagtacggcgataaagagtcc
gtcagaaatgcaggcactgcgaagtccgccacgcatatgctcaagatggcttatgtcatc
tggttcatcaaaacccaactgcaggaaaaccgctcctcgacgttaagagaaatgtattac
atctctgagggctggaaacaggcgaagttcggagcccagaacgagagcaattatctgatt
gaggatctggagatcatcactgctctccagagggaatttttccatatgcgtccggaagag
gacggcgcctcgatcttcggtccgatccgtgtccgggaaaatacccggcgcggtatgaaa
gagattcactgtcaggatgatgtgggagaagccggatacaatattccgaataatgtggag
aatgtcgagcttgtcgatcacgacgcctcctgtgttatcgcgatagaaaccggtggtatg
ttctcccgtctgcaggaaaacggttttgatgaagagtacaatgctgttcttcttcacctg
aagggtcagccggcccgagcaacgcggcgcatgctgaaacgcatgaacgaggagctggga
atccccgtcgttgttttcacggacggagatccctggtcctaccgcatttatgcatcagtc
gcctatggttctatcaagtcagcccacatgtccgaacttctggcaacgccttctgcccag
ttcatcggggtaaaaccatccgatatccagcggtacaatctgcctgccgataaacttaca
gaacaggatgtttctgcgctgaaggcggaactcaccgatccgagatttgcaaccgacttc
tggaaaaaagagatcaatcttcagctggagatgaatctcaagtctgaacagcaggcattt
gcaagccgcggtcttgatttcgttactaaggagtatcttccatcgatgctctccgagata
ggtgttttaaagcgctaa

DBGET integrated database retrieval system