KEGG   Methanocorpusculum labreanum: Mlab_1394Help
Entry
Mlab_1394         CDS       T00472                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mla  Methanocorpusculum labreanum
Pathway
mla00260  Glycine, serine and threonine metabolism
mla00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mla01100  Metabolic pathways
mla01110  Biosynthesis of secondary metabolites
mla01130  Biosynthesis of antibiotics
mla01230  Biosynthesis of amino acids
Module
mla_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mla00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mlab_1394
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mlab_1394
Enzymes [BR:mla01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mlab_1394
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABN07560
UniProt: A2STA4
Position
complement(1423785..1424963)
Genome map
AA seq 392 aa AA seqDB search
MKEKTGYYGEFGGRFVPETLMAALYELDSAYHRLKDDPGFKAELNSYLTEFAGRETPLTF
CRNMSEYCGCKVYLKREDLVHGGAHKLNNTLGQALLAKAMGKKRLIAETGAGQHGVATAI
AGAALNLPVEVFMGEEDCERQKLNVFRMELMGAKVHPVSSGTKTLKDATNEALREWAKTV
DYTHYLIGSVVGPHPFPMIVRDFQSVIGEETRRQCLEKEGRLPDTLVACVGGGSNAIGMF
YPMLNDDVRMVGVEAGGRALTPGNNGATLNTGSPGILHGALSYLIQNDDGQVGVTHSISA
GLDYPGVGPEHSMLKDLNRVEYSYVMDDEVLEAFSYLSRTEGIIPALESAHAVSYVLKNR
DSFDRDDIVVICLSGRGDKDVSSVSKMFGGEE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaaaacaggatattatggagagttcggcggaagattcgtccccgaaacactc
atggcggctctctacgagctggacagcgcgtaccacagattaaaagacgacccggggttc
aaggctgaactcaactcgtatctgacggagtttgccggacgcgagacgccccttacgttc
tgcaggaatatgtctgagtactgcgggtgtaaggtctatctcaagcgcgaggatcttgtt
cacggcggggcgcataaactcaataacacccttgggcaggctcttctcgcaaaagcaatg
ggtaaaaaacgcctgatcgcagagaccggggccggacaacacggcgttgcaacggcaatt
gccggagcggctctcaatctgccggtcgaagtgttcatgggcgaggaagactgcgagaga
cagaaactgaacgtatttagaatggaactcatgggggcgaaggtccatcctgtcagttcc
gggacgaagacactgaaggatgcaaccaacgaggccttgcgcgaatgggcaaagaccgtt
gactacacccactatctgattggatcggttgtgggtccccaccccttccccatgatcgtc
agggacttccagtcggtcatcggtgaggaaacaagacgtcagtgtcttgagaaagaagga
agactcccggacacgcttgttgcctgcgtcggcggtggctcgaatgcgataggaatgttt
tacccgatgctgaacgacgacgtccggatggtcggcgtggaagcaggagggcgtgccctc
actcccggaaataacggtgcaacgctgaacaccggcagtccagggattctgcacggggct
ctttcctatcttatccagaatgatgacggacaggtcggcgtgacgcattccatctcggct
ggactcgactaccccggggtcgggcctgaacacagcatgctgaaagatttgaatcgtgtc
gagtattcctacgtgatggatgacgaggtccttgaggccttctcctatctttcacggacg
gaaggtatcattccagctctcgaatcggcccatgcggtatcgtatgttctcaaaaacagg
gattctttcgaccgcgatgatatcgtggtcatatgcttatccggaagaggggataaggat
gtctcgtcggtttcaaagatgtttggaggtgaggagtaa

DBGET integrated database retrieval system