KEGG   Methanocorpusculum labreanum: Mlab_1416Help
Entry
Mlab_1416         CDS       T00472                                 

Definition
(GenBank) pyruvate ferredoxin oxidoreductase, delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
mla  Methanocorpusculum labreanum
Pathway
mla00010  Glycolysis / Gluconeogenesis
mla00020  Citrate cycle (TCA cycle)
mla00620  Pyruvate metabolism
mla00640  Propanoate metabolism
mla00650  Butanoate metabolism
mla00680  Methane metabolism
mla00720  Carbon fixation pathways in prokaryotes
mla01100  Metabolic pathways
mla01120  Microbial metabolism in diverse environments
mla01130  Biosynthesis of antibiotics
mla01200  Carbon metabolism
Module
mla_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mla_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mlab_1416
   00020 Citrate cycle (TCA cycle)
    Mlab_1416
   00620 Pyruvate metabolism
    Mlab_1416
   00640 Propanoate metabolism
    Mlab_1416
   00650 Butanoate metabolism
    Mlab_1416
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Mlab_1416
   00680 Methane metabolism
    Mlab_1416
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Mlab_1416
Enzymes [BR:mla01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Mlab_1416
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_7 Fer4_2 Fer4_6 Fer4_10 Fer4_21 Fer4_9 Fer4_16 Fer4_8 Fer4_13 Fer4_15 Fer4_17 Fer4_4 Fer4_22
Motif
Other DBs
NCBI-ProteinID: ABN07582
UniProt: A2STC6
Position
1446415..1446681
Genome map
AA seq 88 aa AA seqDB search
MALGIGCTARPGNSRNNKTGSWRVFYPVMDTEKCTKCGTCQLICPEGCINQNPDKTYSID
LDFCKGCGMCAEECPDKAKAIHMVKEEK
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atggctcttggaattggatgcacggcacgcccgggcaacagcagaaacaacaaaaccggt
tcatggagagtattctacccagtaatggacacggaaaaatgtacaaaatgtggaacatgt
cagctgatctgtccagaaggttgtatcaatcagaatcctgacaaaacctattctatcgat
cttgacttctgtaaaggatgcggcatgtgcgccgaggaatgtcctgacaaagctaaggct
atccacatggttaaggaggaaaaataa

DBGET integrated database retrieval system