KEGG   Methanocorpusculum labreanum: Mlab_1420Help
Entry
Mlab_1420         CDS       T00472                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mla  Methanocorpusculum labreanum
Pathway
mla00260  Glycine, serine and threonine metabolism
mla00750  Vitamin B6 metabolism
mla01100  Metabolic pathways
mla01110  Biosynthesis of secondary metabolites
mla01120  Microbial metabolism in diverse environments
mla01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mla00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mlab_1420
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mlab_1420
Enzymes [BR:mla01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mlab_1420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP zinc_ribbon_2 EutA Prok-E2_C DZR Ribosomal_L40e PhnA_Zn_Ribbon
Motif
Other DBs
NCBI-ProteinID: ABN07586
UniProt: A2STD0
Position
complement(1449456..1450655)
Genome map
AA seq 399 aa AA seqDB search
MYKLVCVHCGAEYPPDAIVYNCEKCGHLLAVKYDLSKITITHEEILQRPISLWRYKEFLP
VQIEPVTLQEGGTPLYHLKRLGEELGLTNLYAKHEGMNPSGSFKDRGMTLGVSMAKQLGK
NIVACASTGNTSASMAVYAAKANMPAVVLLPAGHVALGKVAQALMHGAKVISIRGNFDRA
LEMVHELCISHGIYLLNSINPYRLEGQKTIGFEVVDQLGCVPDRIVLPVGNAGNISAVYK
GLCEWKEIGYIDRLPKMTAIQAEGAAPVVAAIKGQLPEVVVEQNPETVASAIRIGAPVNA
EKALRAIRETGGTAESVTDAEILAMQRDLARYEGIGVEPASAASVAGIRKMAEMGLLDKD
EKIVCVVTGHLLKDPETVIKQCAPPIEIDPTIEALLAVL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtataaactcgtctgtgtacactgcggcgctgagtatccgcctgacgccattgtgtat
aattgtgagaaatgcggccacctgcttgcagttaagtatgatctgagcaagatcacgatt
actcacgaagaaatattacagcgtcctatctccctctggcgctacaaagagttccttcca
gtccagattgagccggtcacccttcaggaaggaggtacgcctttgtatcacctgaaaaga
cttggggaagagctgggtctgaccaatctgtatgcaaagcacgagggtatgaacccgtca
ggatcattcaaagaccgcggtatgacccttggtgtttctatggcaaaacagctcggcaaa
aatatcgttgcctgcgcgtccactggaaatacctcggcatcgatggcggtttatgcagca
aaagcaaatatgccggcagttgttttactgcccgccggccatgttgctcttggcaaagtt
gcccaggcacttatgcatggagcaaaggtcatttcgattcggggtaactttgaccgcgcc
cttgagatggtgcatgaactctgtatttcccatggaatttatctcttaaactccatcaac
ccatatcgtcttgaaggacagaaaacgattgggttcgaagtagtcgatcagcttggctgc
gttccggacagaattgttctgccggtaggaaatgccggaaacatatctgccgtctacaaa
ggattatgcgagtggaaagagatcggatacattgaccgccttccaaaaatgacagcaatt
caggccgagggcgcggctccagtcgtagccgcaatcaaaggtcagcttccggaagttgtt
gttgagcagaaccctgaaacggttgcctccgcaattcgtatcggagctccggtgaatgca
gaaaaagctctgcgtgcaattcgcgagaccggcggaactgcagagtcagtgaccgatgcc
gagattcttgctatgcagcgcgatctcgccagatacgaaggtatcggtgttgaacctgca
tctgcagcctcagttgcaggtatccgcaagatggcggagatgggacttctcgacaaggat
gaaaagatcgtatgtgtcgtgaccggccacctgctgaaagaccctgaaactgtaattaaa
caatgcgccccgccaatcgagatcgacccaaccatcgaagcactgcttgctgtattgtaa

DBGET integrated database retrieval system