KEGG   Methanocorpusculum labreanum: Mlab_1668Help
Entry
Mlab_1668         CDS       T00472                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
mla  Methanocorpusculum labreanum
Pathway
mla00010  Glycolysis / Gluconeogenesis
mla00052  Galactose metabolism
mla00500  Starch and sucrose metabolism
mla00520  Amino sugar and nucleotide sugar metabolism
mla00521  Streptomycin biosynthesis
mla01100  Metabolic pathways
mla01110  Biosynthesis of secondary metabolites
mla01120  Microbial metabolism in diverse environments
mla01130  Biosynthesis of antibiotics
mla01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mla00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mlab_1668
   00052 Galactose metabolism
    Mlab_1668
   00500 Starch and sucrose metabolism
    Mlab_1668
   00520 Amino sugar and nucleotide sugar metabolism
    Mlab_1668
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mlab_1668
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Mlab_1668
Enzymes [BR:mla01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Mlab_1668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N
Motif
Other DBs
NCBI-ProteinID: ABN07829
UniProt: A2SU23
Position
1700731..1701702
Genome map
AA seq 323 aa AA seqDB search
MSNESTSSSTMDDHSYVAAVDLGATHLRAGIIDEEGEIQAFSQNEVKDCQSAVDIRLLIC
SMIEDLGETSGITPKAIGVSTAGPVDLKTGSVVGSPNMKCEQIFLAGPLEERFGIQVTMM
TDCKAGVLGEYYFGGAKDAETLVYLTFSTGIGAGVLERGKLLCGSNGNASEAGHFLVDTT
WNLPCGCGGTGHWEAYASGTGIPNFFQAWREARGDSEPKSSLNAGQILYIGNWGNPLFSS
FCDELAKINGRGISSVIAAYNPDLIVMDGPIVRNYPSLIAGRMTEYIDHYLTIPEIRISA
LEGKGPLLGASVSAFKALERRKL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgaaagcacatctagcagtacgatggatgatcattcgtatgttgccgcagtc
gatctgggagcgacgcatctgcgtgcaggaatcatagatgaagagggagagatccaggca
ttttcccaaaatgaggtcaaagattgccaaagcgccgtggatatccggttgctgatctgc
agtatgatcgaggatctcggcgaaacttcgggaattacgcccaaagcgatcggcgtcagc
accgcgggacccgtcgatctgaagaccggttcggtcgtcggttcgcccaatatgaaatgc
gaacagatctttcttgccggaccactggaggaaaggttcggcatccaggttacgatgatg
accgactgcaaagcgggcgtccttggcgagtattacttcggcggggcaaaggatgcggaa
acgctcgtctatctgaccttttccaccgggatcggggcaggagtcctggagaggggaaaa
ctcttgtgcggttcgaacggaaatgcctcagaggccggccactttctcgtggacacgacc
tggaatctcccctgcggatgcggagggaccggacactgggaagcctacgcgagcggaacg
ggcatcccaaactttttccaggcatggagagaggctcgcggcgattccgaaccgaaatcc
tcgctgaatgcaggacagatcctctacatcgggaattggggaaacccgctgtttagctct
ttctgcgatgaactcgcaaaaataaacgggcggggcatttcctcggtgattgcggcctac
aatcccgatctcatcgtaatggacggacccatcgtcagaaactatccgtcgcttattgcc
ggaagaatgaccgaatacatcgatcactacctcacgattcccgagatccggatctccgct
ctcgagggaaagggccctctgctcggcgcgtcggtctctgcgttcaaagcgcttgaacgc
aggaaattatga

DBGET integrated database retrieval system