KEGG   Mesoplasma lactucae: CP520_03290Help
Entry
CP520_03290       CDS       T05127                                 

Definition
(GenBank) adenylosuccinate synthase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
mlac  Mesoplasma lactucae
Pathway
mlac00230  Purine metabolism
mlac00250  Alanine, aspartate and glutamate metabolism
mlac01100  Metabolic pathways
Module
mlac_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:mlac00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CP520_03290
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CP520_03290
Enzymes [BR:mlac01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     CP520_03290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt DUF1033
Motif
Other DBs
NCBI-ProteinID: ATG97734
UniProt: A0A291ISL3
Position
747278..748582
Genome map
AA seq 434 aa AA seqDB search
MLNSRDYKTLVVVGSQWGDEGKGKITDFYAQDADLVVRFAGGDNAGHVIWNEGKKYKVTI
VPSGILNPKVMNVIGNGCVVNLNKLNDEMAILNKAGVDTKNLFVSDRAHVIFKYNEVIDE
LQEEQRQNRKIGTTKRGIGPTYADKASRCGIRICDFAEPNFKDLLEEQVEYHNKLITDIY
GGQPLDFNTIYEDALKQYANIKDRIVDSGSYVNQAIRDNKFVLFEGAQGVLLDIDHGTYP
FVTSSNTTANNVSIGTGIHNKLINKVVGVAKAYDTRVGTGGFPTELLDATGDRIRERGHE
YGSNTGRPRRIGWFDAVAMNYSIRTGGLDALFITLLDVLDTEETVKICTGYKYNGKVIDT
IPASNTEYEKCEPVYEELPGWQEDITKVTSFDQLPKNAQNYINRIAELCDVAIQGFSVGP
DRHQTVTMLDKFEG
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgctaaatagtagagattataagactcttgttgtggttggttcacaatgaggtgatgaa
ggaaaagggaaaattactgacttttacgcgcaagatgcagacttagttgttcgttttgct
ggtggagataatgctggtcacgtaatttgaaatgaaggtaaaaaatataaagtaacaatt
gtaccttcaggaatcttaaaccccaaagttatgaacgtaattggaaacggttgtgttgtt
aacttaaataaattaaatgatgaaatggctatcttaaacaaagctggagttgatacaaaa
aacctatttgtatcagatagagctcacgttatttttaaatacaatgaagtaattgatgaa
ttacaagaagaacaaagacaaaatagaaaaatcggaactacaaaaagaggaattggtcca
acttatgctgataaagcatcacgttgtggaatcagaatctgtgattttgcagaacctaat
ttcaaagacttattagaagaacaagttgaataccacaataaattaattacagatatttat
ggtggacaaccattagacttcaacaccatctatgaagatgcattaaaacaatatgcaaac
attaaagatagaattgttgattctggaagctatgtaaaccaagcaattagagataataaa
ttcgttttatttgaaggagcacaaggagttcttttagatatcgatcatggaacttatcca
tttgtaacaagttcaaatacaactgcaaacaacgtaagtattggaacaggaatccacaac
aaactaattaataaagttgttggggttgctaaagcttatgatactcgtgttggaactggt
ggattcccaacagaattactagatgcaactggagatagaattcgtgaacgtggtcacgaa
tatggatcaaatactggacgtcctcgtcgtattggatgatttgatgctgtagccatgaat
tattcaattagaactggtggattagatgctttattcattactttattagatgttcttgat
acagaagaaactgtaaaaatttgtacaggttacaaatacaatggaaaagttattgatact
attccagcatcaaatactgaatatgaaaaatgtgaaccagtttatgaagaactacctgga
tgacaagaagatattactaaggtgacttcatttgaccaattacctaaaaatgctcaaaac
tacattaacagaattgctgaattatgtgatgtagcaatccaaggtttctcagttggacca
gaccgtcatcaaacagtaactatgttagataaatttgaaggttaa

DBGET integrated database retrieval system