KEGG   Mycobacterium leprae Br4923: MLBr00238Help
Entry
MLBr00238         CDS       T00842                                 

Gene name
metS
Definition
(GenBank) putative methionyl-tRNA synthase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mlb  Mycobacterium leprae Br4923
Pathway
mlb00450  Selenocompound metabolism
mlb00970  Aminoacyl-tRNA biosynthesis
mlb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mlb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MLBr00238 (metS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MLBr00238 (metS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mlb01007]
    MLBr00238 (metS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mlb03016]
    MLBr00238 (metS)
Enzymes [BR:mlb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     MLBr00238 (metS)
Amino acid related enzymes [BR:mlb01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   MLBr00238 (metS)
Transfer RNA biogenesis [BR:mlb03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MLBr00238 (metS)
 Prokaryotic type
   Other AARSs
    MLBr00238 (metS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: CAR70331
UniProt: A0A0H3MPD0
Position
complement(312224..313837)
Genome map
AA seq 537 aa AA seqDB search
MRPYYITTAIAYPNAAPHIGHAYEYIATDAIARFKRLDGLDVRFLTGTDEHGLKVAQAAE
AAGVPTAQLARRNSGVFQRMQEALHISFDRFIRTTDADHYKAAKEIWRRMDAAGDIYLGT
YSGWYSVRDERFFVDSETKLLDNGIRVAVETGTPVTWTEKEQTYFFRLSAYVDKLLAHYD
ANPDFIGPEVRRNEVISFVSGGLEDFSISRTSFDWGVQVPEHPDHVMYVWIDALTNYLTG
AGFPDTDSELFGRYWPANLHMIGKDIIRFHAVYWPAFLMSAGIELPRRIFAHGFLHNHGE
KMSKSVGNIVDPMALVQTFGVDQVRYFLLREIPFGQDGNYSEEAIITRMNTDLANEFGNL
AQRSLSMVAKNLGGVVPEPSEFTSADTALLTTADGLLERVRGNFDGQAMNLALEAIWLML
GEANKYFSSQQPWILRKSESEADQARFRTVLYTTCEVVRIAALLVQPVMPESAGKMLDLL
GQEEDQRAFTAVSVRLAPGTVLPPPTGVFPRYQPSEIEGADPVKSSSKRREHNKRRE
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgaggccctattacatcaccactgccatcgcgtatcccaacgctgcgccgcacattggt
cacgcgtacgaatacatcgccaccgacgcgattgcccgcttcaagcggcttgacggctta
gatgtgcgcttcctgaccggaaccgacgagcacggcctgaaggtcgcacaggccgccgaa
gcagccggcgtgccgacagcgcaacttgccaggcgcaattcgggtgtatttcagcgcatg
caagaggcactccacatttccttcgatcggttcatccgcaccaccgacgccgaccactac
aaggcagctaaggaaatctggcggcgaatggatgcggccggcgacatctacctaggtacc
tattccgggtggtactcggtgcgcgacgagaggtttttcgtcgactcggagaccaaactt
ctcgataacggcatccgagtagcagtagaaaccggcacaccagtcacctggactgagaaa
gagcagacctactttttccgactgtcggcatatgtcgacaaattgctagcccactacgac
gccaaccccgacttcatcggacccgaggtgcgtcgcaacgaagtgatcagctttgtctcc
ggtgggctggaagatttctcaatctcgcgcacttcattcgactggggtgtacaggtccca
gaacatcctgaccatgtcatgtacgtctggatcgacgcgctaaccaactacctcaccgga
gccgggttcccggacaccgactcggagttgttcggtcgttactggcccgctaatctacac
atgatcggcaaagacatcatcaggttccatgccgtatactggccggcgtttttgatgtca
gccggaatcgagctgccacgaaggattttcgcacacgggttcttacacaaccacggcgag
aagatgagcaagtcggtgggcaatatcgttgacccgatggcgctggtacaaacgttcggc
gtggatcaggttcgatattttctgttgcgcgagatcccgttcggccaggacggcaactac
agcgaagaggcgatcatcacccggatgaacaccgacctggccaacgaattcggcaatctg
gcgcagcgctcgttgtcgatggttgccaagaacctgggcggcgtagtgcctgaacccagt
gagttcacctccgccgacactgcgcttctcacgacggccgacggcttgctggagcgggtg
cgcggcaactttgacggacaggcgatgaacctggccctggaagctatttggctgatgctc
ggcgaagctaacaagtacttttcgtcgcaacagccctggatcttgcgtaagagcgagtct
gaagcggatcaggccaggttccgtaccgtcctctacacgacttgcgaggtggtgcggatt
gcggcgttgcttgtccagcccgttatgccggaatcggccggcaagatgttggacttgctt
ggccaggaggaagaccaacgggcattcactgccgtcagtgtgcggctggcccccggcacg
gtgctgccgccacccaccggtgtgttcccccgctaccagccttccgaaatcgagggagcg
gaccccgtgaagtcgagcagcaagcggagagaacacaataagcgacgggagtga

DBGET integrated database retrieval system