KEGG   Mycobacterium leprae Br4923: MLBr00560Help
Entry
MLBr00560         CDS       T00842                                 

Gene name
ribH
Definition
(GenBank) 6,7-dimethyl-8-ribityllumazine synthase
  KO
K00794  6,7-dimethyl-8-ribityllumazine synthase [EC:2.5.1.78]
Organism
mlb  Mycobacterium leprae Br4923
Pathway
mlb00740  Riboflavin metabolism
mlb01100  Metabolic pathways
mlb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mlb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    MLBr00560 (ribH)
Enzymes [BR:mlb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.78  6,7-dimethyl-8-ribityllumazine synthase
     MLBr00560 (ribH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DMRL_synthase
Motif
Other DBs
NCBI-ProteinID: CAR70653
UniProt: B8ZUN3
Structure
PDB: 

Position
677615..678097
Genome map
AA seq 160 aa AA seqDB search
MSGGAGIPEVPGIDASGLRLGIVASTWHSRICDALLAGARKVAADSGIDGPTVVRVLGAI
EIPVVVQELARHHDAVVALGVVIRGDTPHFDYVCNSVTQGLTRIALDTSTPVGNGVLTTN
TEKQALDRAGLPTSAEDKGAQAAAAALTTALTLLNLRSRI
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgagtggtggagccggtattccggaggttccggggatcgacgcttccggtctgcggcta
ggtattgtcgcaagcacctggcacagcagaatttgcgatgcgctgttggcgggcgcgcgc
aaagttgctgccgactcgggtatcgatggcccgacagtagtccgtgtgctcggtgccatc
gaaattccggtagtggtgcaggagctcgctcgccaccacgatgcagttgttgccctgggt
gtcgtgatccgtggcgatacaccacatttcgattatgtttgcaattccgtaacgcaaggc
ttgacgcgcatagcgctagatacctcgacgccggttggcaacggtgtgctgaccaccaat
accgagaaacaggcgctggatcgggctgggcttccgacgtcggccgaagacaagggggcc
caggcggcagctgctgcgctgaccaccgcattgaccctgcttaacttgcgttctcggata
tga

DBGET integrated database retrieval system