KEGG   Mycobacterium leprae Br4923: MLBr01464Help
Entry
MLBr01464         CDS       T00842                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
mlb  Mycobacterium leprae Br4923
Pathway
mlb00330  Arginine and proline metabolism
mlb00332  Carbapenem biosynthesis
mlb01100  Metabolic pathways
mlb01130  Biosynthesis of antibiotics
mlb01230  Biosynthesis of amino acids
Module
mlb_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:mlb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    MLBr01464 (proB)
  09110 Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    MLBr01464 (proB)
Enzymes [BR:mlb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     MLBr01464 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA ACT_7
Motif
Other DBs
NCBI-ProteinID: CAR71558
UniProt: B8ZRN2
Position
complement(1761493..1762596)
Genome map
AA seq 367 aa AA seqDB search
MSVHRDAIRAARSLVVKVGTNALTTSSGVFDSSRLARLVDAIEARMKAGTDVVIVSSGAI
AAGIEPLGLSLRPKDLATKQAAASVGQVALVNSWSAAFARYGRAVGQVLLTAQDISMRVQ
HTNAQRTLDRLRALHAVAIVNENDTVATNEIRFGDNDRLSAVVAHLVGAEALVLLSDING
LYDSDPRKNTGARFVPEVTGSADLDGVVASRGSSLGTGGMVSKMSSALLAADAGVPVLLA
AAADAATALTDASVGTVFAARPDRMSARRFWLRYAADSVGSLTLDEGAVWAVVQQRRSLL
AAGITAVSGRFYGGDVVELRGPDATMVARGVVAYDATELAAMMGRSTSELPCELRRPAVH
ADDLVSI
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgtacatcgcgacgcgatcagagctgctcggagtttggtcgtcaaggttgggact
aacgcgctcaccacatcatccggagtattcgattctagccggctggccagactggtcgac
gcgatagaggcgcggatgaaggccggtactgatgtggtcatcgtgtcttcgggtgccatc
gccgccggcattgagccgcttggattatcacttcgcccaaaagatttagcgaccaagcag
gctgcggccagcgtcgggcaagttgcgctggtaaactcctggagcgcagcgttcgcccgg
tatggtcgcgcggtagggcaggtgctgctgactgcgcaggatatttcgatgcgagtccaa
cacactaacgctcaacgcaccctagaccggttgcgggcgcttcatgcggtggcaatcgtc
aacgagaacgacaccgtggctaccaacgagatccggttcggtgacaacgatcggctttcg
gcggtggtggcgcacctggtcggtgccgaagctttagtgctgctatccgatatcaatggt
ctctacgattcggatccgcggaagaataccggtgcgcgctttgttcctgaggtgaccggg
tcggcagatctcgatggtgtggtcgccagccggggcagttccttgggaacaggtggaatg
gtatcgaagatgtcatcggcgctactggccgccgacgcgggtgtgccggtgctgctggct
gccgcggctgacgccgcgactgcgcttaccgatgcctcggttggcacagtgttcgccgcg
cggccggaccggatgtccgcccggcggttctggttgcgctatgctgccgactctgtcggc
tcgttaaccctcgacgagggtgcggtatgggcagtggtacagcaacgccgctcgctgctg
gccgcgggtatcaccgcggtttcgggccggttctacggcggtgatgtcgtggaattgcgc
ggaccagacgcgacgatggtcgcccgcggtgtggtcgcctatgacgcgaccgagctggcc
gccatgatgggccggtcgacctcggagctgccttgcgagctgcgccggcccgcggtgcac
gccgacgacctcgtctcgatttga

DBGET integrated database retrieval system