KEGG   Mycobacterium leprae Br4923: MLBr02162Help
Entry
MLBr02162         CDS       T00842                                 

Gene name
fadA
Definition
(GenBank) putative beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mlb  Mycobacterium leprae Br4923
Pathway
mlb00071  Fatty acid degradation
mlb00280  Valine, leucine and isoleucine degradation
mlb00310  Lysine degradation
mlb00362  Benzoate degradation
mlb00380  Tryptophan metabolism
mlb00620  Pyruvate metabolism
mlb00630  Glyoxylate and dicarboxylate metabolism
mlb00640  Propanoate metabolism
mlb00650  Butanoate metabolism
mlb00900  Terpenoid backbone biosynthesis
mlb01100  Metabolic pathways
mlb01110  Biosynthesis of secondary metabolites
mlb01120  Microbial metabolism in diverse environments
mlb01130  Biosynthesis of antibiotics
mlb01200  Carbon metabolism
mlb01212  Fatty acid metabolism
mlb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mlb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MLBr02162 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    MLBr02162 (fadA)
   00640 Propanoate metabolism
    MLBr02162 (fadA)
   00650 Butanoate metabolism
    MLBr02162 (fadA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    MLBr02162 (fadA)
   00072 Synthesis and degradation of ketone bodies
    MLBr02162 (fadA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MLBr02162 (fadA)
   00310 Lysine degradation
    MLBr02162 (fadA)
   00380 Tryptophan metabolism
    MLBr02162 (fadA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MLBr02162 (fadA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MLBr02162 (fadA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    MLBr02162 (fadA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mlb04147]
    MLBr02162 (fadA)
Enzymes [BR:mlb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MLBr02162 (fadA)
Exosome [BR:mlb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MLBr02162 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CAR72259
UniProt: A0A0H3MW33
Position
complement(2571232..2572443)
Genome map
AA seq 403 aa AA seqDB search
MSEEAFIYEAIRTPRGKQKNGSLHEVKPVSLVVGLVEELRKRNPDLDENLISDVILGCVS
PVGDQGGDIARATVLAAGLPVTAGGVQLNRFCASGLEAVNTAAQKVRSGWDDLVLAGGVE
SMSRVPMGSDGGAMGLDPATNYDVMFVPQGIGADLIATIEGFSRDDVDVYALRSQEKAAA
AWSGGYFAKSVVPVRDQNGLLILDHDEHMRPDTSKEGLAKLKPAFEGLAAMGGFDDVALQ
KYHWVEKINHVHTGGNSSGIVDGAALVMIGSEAVGKSQGLTPRARMVATATSGADPVIML
TGPTPATRKVLDRAGLTVDDIDLFELNEAFASVVLKFQKDLNIPDEKLNVNGGAIAMGHP
LGATGAMILGTMVDELERCNARRALVTLCIGAGMGVATIIERV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaagaagctttcatctatgaggccatccgcacccctcgcggtaagcagaagaac
ggatcgttgcacgaggtcaagccggtaagcctggtcgttgggctagtcgaggaattgcgt
aagcgaaaccccgatctcgatgagaacctgatcagcgacgtcatcttgggatgcgtctca
ccggtgggcgatcagggcggtgacattgcccgcgccacggtgctggccgctggcctgcct
gtcaccgcaggcggggtgcagctcaaccggttctgcgcatcggggcttgaagccgttaac
accgccgcgcagaaggtgcgctctggctgggatgacctggttctggctggcggtgtggag
tcgatgagccgggtgccgatgggatccgatggcggcgcgatgggcttggacccggcgact
aactacgacgtcatgttcgtcccgcagggcattggtgccgacctgatcgccaccatcgag
ggcttctcgcgtgatgacgtcgacgtctatgcgttgcgcagccaggagaaggccgcggcc
gcgtggtcgggcggctacttcgccaagtcggtggttccggtgcgcgaccagaatggtctg
ttgatcctcgatcacgacgagcacatgcggcccgacacctccaaggagggcctggccaag
ctgaagcccgccttcgagggtcttgccgcgatgggtggtttcgacgacgtggccctgcag
aaatatcactgggtggagaagatcaaccacgttcacaccggaggtaacagctccggcatc
gtcgacggcgcggcactggtgatgattggcagcgaagctgttggcaagtcccagggcctg
actccgcgggcgcgcatggtagccaccgctaccagtggggccgacccggtcatcatgctg
accggccccacccccgccacccgcaaggtgctcgaccgcgccgggttgactgttgatgac
atcgacctgttcgagttaaacgaggcgtttgcgtcggtggttctgaaattccagaaagac
ctgaacattccggacgagaagctcaacgtcaacggcggtgctatcgcgatgggtcacccg
ctgggtgccaccggcgcgatgatcctcgggaccatggtcgacgaactggagcgctgcaac
gcgcggcgtgcgctcgtcacgctatgtatcggcgccggcatgggtgttgccaccatcatc
gagagggtttaa

DBGET integrated database retrieval system