KEGG   Mycoplasma leachii PG50: MSB_A0038Help
Entry
MSB_A0038         CDS       T01367                                 

Definition
(GenBank) mannitol dehydrogenase C-terminal domain protein
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
mlc  Mycoplasma leachii PG50
Pathway
mlc00051  Fructose and mannose metabolism
mlc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mlc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MSB_A0038
Enzymes [BR:mlc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     MSB_A0038
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-ProteinID: ADR24177
UniProt: E4PT12
Position
40421..41407
Genome map
AA seq 328 aa AA seqDB search
MNLIHFGAGNIGCGFIAPILSSIVDHIYFVDNNIDIVNKINTQKLIKIHTSDNKKISITN
ISSWLLTDFINYKNTWNEVSLLTISIGIKNLKHIIYYVNQLINYKIKNNQKLIIMCCENG
IRVSSLFKSYFSNLNNNIYFVDVLVDRIVSNKNILNDYLECENYYLWVVDKTQWPSDFKQ
IPNLTYTTSFDIQIIKKIYMLNALHCSIAWFVFKNFSFNKYLYVYQALKNDKVIEFINNY
LNEVILVLNHKYNISLNELNDYKIQIIKRLNNSFIKDDLKRLVRNTELKLSKNERILTIL
DYAKVSNLKHDTLLLSYQNGLEYLKNNK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaattcactttggagcaggaaatatcggttgtggttttattgctccaatttta
agctctattgttgatcatatttattttgttgataacaatattgatattgttaataaaata
aatactcagaaattaattaaaatacatacttcagataataaaaaaataagtataactaac
atttcatcttgactattaactgattttataaattataaaaatacttgaaatgaagttagt
ttattaactatttcaattggaattaaaaacttaaaacatattatttattatgttaatcaa
ttaataaattataagatcaaaaataatcaaaaactaattattatgtgctgtgaaaatggg
attagagttagtagcttatttaagtcttatttttctaatttaaacaataatatttatttt
gttgatgttttagttgataggatagttagtaataaaaacattttaaatgattatttagaa
tgtgaaaattattatttatgagttgttgataaaactcagtgaccaagtgattttaaacaa
atacctaacttaacttatacaactagttttgatatacaaataattaaaaagatttatatg
ttaaatgctttgcattgttctatagcttggtttgtttttaaaaactttagttttaacaag
tatttatatgtttatcaagctttaaagaatgataaagtaattgaatttattaataactat
ttaaatgaagtaattttagttttaaatcataaatataatattagtttaaatgaattaaat
gattataagattcaaataattaaaagattgaataatagttttataaaagatgatcttaaa
agattagttagaaatactgaattaaaactaagtaaaaatgaaagaattttaactatttta
gattatgctaaagttagtaatttaaaacacgacacacttttattaagctatcaaaacgga
ttagaatatttaaagaataataaatag

DBGET integrated database retrieval system