KEGG   Mycobacterium leprae TN: ML1158Help
Entry
ML1158            CDS       T00047                                 

Gene name
fadA4
Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mle  Mycobacterium leprae TN
Pathway
mle00071  Fatty acid degradation
mle00280  Valine, leucine and isoleucine degradation
mle00310  Lysine degradation
mle00362  Benzoate degradation
mle00380  Tryptophan metabolism
mle00620  Pyruvate metabolism
mle00630  Glyoxylate and dicarboxylate metabolism
mle00640  Propanoate metabolism
mle00650  Butanoate metabolism
mle00900  Terpenoid backbone biosynthesis
mle01100  Metabolic pathways
mle01110  Biosynthesis of secondary metabolites
mle01120  Microbial metabolism in diverse environments
mle01130  Biosynthesis of antibiotics
mle01200  Carbon metabolism
mle01212  Fatty acid metabolism
mle02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mle00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ML1158 (fadA4)
   00630 Glyoxylate and dicarboxylate metabolism
    ML1158 (fadA4)
   00640 Propanoate metabolism
    ML1158 (fadA4)
   00650 Butanoate metabolism
    ML1158 (fadA4)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ML1158 (fadA4)
   00072 Synthesis and degradation of ketone bodies
    ML1158 (fadA4)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ML1158 (fadA4)
   00310 Lysine degradation
    ML1158 (fadA4)
   00380 Tryptophan metabolism
    ML1158 (fadA4)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ML1158 (fadA4)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ML1158 (fadA4)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ML1158 (fadA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mle04147]
    ML1158 (fadA4)
Enzymes [BR:mle01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ML1158 (fadA4)
Exosome [BR:mle04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ML1158 (fadA4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-GeneID: 910257
NCBI-ProteinID: NP_301848
Pasteur: ML1158
UniProt: P46707
Position
1352912..1354093
Genome map
AA seq 393 aa AA seqDB search
MTTSVIVTGARTPIGKLMGSLKDFSASDLGAITIAAALKKANVAPSIVQYVIIGQVLTAG
AGQMPARQAAVAAGIGWDVPALTINKMCLSGLDAIALADQLIRAGEFDVVVAGGQESMTK
APHLLMDSRSGYKYGDVTIVDHLAYDGLHDVFTNQPMGALTEQRNDVEKFTRQEQDEFAA
RSHQKAAAAWKDGVFADEVVPVSIPQSKGDSLQFTEDEGIRANTSAESLAGLKPAFRCGG
TITPGSASQISDGAATVVVMNKEKAQQLGLTWLVEIGAHGVVAGPDSTLQSQPANAIKKA
VDREGISVEQLDVVEINEAFAAVALASARELGIAPELVNVNGGAIAVGHPLGMSGARITL
HVALELARRGSGYGVAALCGAGGQGDALILRAV
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgacatcggtgatcgttactggagcacggacacccattggtaagttgatggggtct
ttgaaggacttttcggctagcgatttgggcgcgatcaccattgccgctgcgctgaagaaa
gccaatgtagcaccttccattgtgcagtacgtgattataggccaggtgttgaccgcgggg
gccggtcagatgccggcgcggcaggcggcagtagcggccggcatcggttgggatgtgccg
gcgctgacgattaacaagatgtgtctgtctggtcttgacgccatcgcactcgctgaccag
ctcattcgcgccggagaattcgatgtggtggtggctggcggccaagagtccatgacgaag
gcaccacatctgctgatggatagccggtcgggttacaagtacggtgacgttaccattgtg
gaccatttagcctatgacggcctgcacgatgtgttcaccaatcagccgatgggcgcgctt
accgaacagcgcaatgatgtcgaaaaattcacgcgccaagaacaggacgagtttgctgcc
cggtcgcaccaaaaggcggcagcggcatggaaggacggcgtcttcgccgacgaagtggtg
ccggtgagtattccgcagagcaaaggtgattcgctgcagttcactgaggatgaggggatt
cgcgccaacaccagtgccgagtctttggccggtctgaagccggcgtttcgctgcggcggc
actattactccaggctctgcgtcgcagatctccgatggtgcagccactgtcgtggtgatg
aacaaggaaaaggcgcagcagctggggttgacttggctggtcgagatcggtgcccacggc
gttgtagccggcccagattctacgttgcaatcccagccggccaacgcaatcaagaaggcg
gttgaccgtgaaggtatctccgtcgagcagctcgatgtcgtagagattaacgaggcgttc
gcggcggtggcgctggcctcagcccgtgaacttggtatcgcccccgagcttgtcaacgtc
aacggcggagcgatcgctgtcggtcaccccctcgggatgtcgggagccagaataacgttg
catgtcgcgctagaattggcgcgtcgcggttcgggttatggtgttgcggctctgtgcggt
gccggtggccagggtgatgcgctgattctgcgggccgtttag

DBGET integrated database retrieval system