KEGG   Mycobacterium leprae TN: ML1583Help
Entry
ML1583            CDS       T00047                                 

Definition
(RefSeq) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
mle  Mycobacterium leprae TN
Pathway
mle00900  Terpenoid backbone biosynthesis
mle01100  Metabolic pathways
mle01110  Biosynthesis of secondary metabolites
mle01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mle00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ML1583
Enzymes [BR:mle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     ML1583
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C
Motif
Other DBs
NCBI-GeneID: 909644
NCBI-ProteinID: NP_302094
Pasteur: ML1583
UniProt: Q9CBU3
Position
complement(1908215..1909435)
Genome map
AA seq 406 aa AA seqDB search
MNNPIEGHAGGRLRVLVLGSTGSIGTQALEVIAANPDRFEVVGLAAGGAQLDTLLRQRAA
TGVTNIAIADDRAAQLAGDIPYHGTDAVTRLVEETEADVVLNALVGALGLRPTLAALHTG
ARLALANKESLVAGGSLVLAAAQPGQIVPVDSEHSALAQCLRGGTPDEVAKLVLTASGGP
FRGWNAGDLERVTPEQAGVHPTWSMGTMNTLNSASLVNKGLELIEANLLFGIPYDRIEVV
VHPQSIVHSMVTFIDGSTIAQASPPDMKLPISLALGWPQRVGGAARACAFTTASTWEFEP
LDIDVFPAVELARHAGQIGGCMTAIYDAANEEAAEAFLQGRIGFPAIVATIADVLQRADQ
WAPQWGEGPATVDDVLDAQRWARERALCAVATASSGKVSDMVLERS
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaatccgatcgaggggcacgctggcggccgcctccgcgtgctggtgttgggaagt
actggctcaattggcacccaggcgctggaagttatcgccgccaatccggaccgtttcgag
gtagtcgggctggccgccgggggcgcgcagctggacacgctgctgaggcagcgcgccgcg
accggcgtcaccaatatcgccatcgctgacgatcgcgcggctcagctggccggcgacatc
ccttaccacgggaccgatgcggtcacccggctggttgaggagactgaggctgacgttgtc
ctcaatgcgctggtcggggcattgggtctgcgacccacactggctgcactgcacacgggc
gcgcgattggcgttggccaacaaggaatcgctggtagctggcggttcgctggtgttggcc
gcggcgcagccaggccagatcgtgcccgtagactcggaacactccgcgctggcgcaatgc
ctgcgcggtggtacccccgacgaagttgctaagttagtgctaaccgcctccggcgggccg
tttcgtggctggaacgccggcgacttggagcgcgttacacccgagcaggcgggcgtccat
ccgacttggtcaatggggacgatgaacacgctgaactcagcgtctctggttaacaagggg
ctcgagctcatcgaagccaacctgttgttcggcattccctacgaccgcattgaggtggtt
gtgcaccctcagtcaattgttcattcgatggtgacattcatcgacggctcgacgatcgcc
caagccagccctccggacatgaagctacctatttctttggcgttgggctggccacagcgg
gtgggtggcgctgctcgagcctgtgctttcactaccgcatctacctgggaattcgagccg
ctggacatcgatgtttttcccgcagtcgagctggcccggcacgctggacagatcggcggc
tgtatgaccgccatttacgatgctgctaatgaggaggctgcagaggccttcctccaaggt
cggatcggcttccccgccatcgtcgcaacaatcgcggatgtgttgcagcgtgccgaccaa
tgggctccccaatggggtgagggacccgctactgtggatgatgtactcgacgcgcagcgc
tgggcccgtgagcgagcgttgtgtgcggtagcaacagcgagttctggaaaggtctctgac
atggtcttagaaaggtcctaa

DBGET integrated database retrieval system