KEGG   Mycobacterium leprae TN: ML1692Help
Entry
ML1692            CDS       T00047                                 

Gene name
serA
Definition
(RefSeq) D-3-phosphoglycerate dehydrogenase
  KO
K00058  D-3-phosphoglycerate dehydrogenase / 2-oxoglutarate reductase [EC:1.1.1.95 1.1.1.399]
Organism
mle  Mycobacterium leprae TN
Pathway
mle00260  Glycine, serine and threonine metabolism
mle00680  Methane metabolism
mle01100  Metabolic pathways
mle01120  Microbial metabolism in diverse environments
mle01130  Biosynthesis of antibiotics
mle01200  Carbon metabolism
mle01230  Biosynthesis of amino acids
Module
mle_M00020  Serine biosynthesis, glycerate-3P => serine
Brite
KEGG Orthology (KO) [BR:mle00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    ML1692 (serA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ML1692 (serA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mle04147]
    ML1692 (serA)
Enzymes [BR:mle01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.95  phosphoglycerate dehydrogenase
     ML1692 (serA)
    1.1.1.399  2-oxoglutarate reductase
     ML1692 (serA)
Exosome [BR:mle04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ML1692 (serA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh ACT NAD_binding_2 AdoHcyase_NAD IlvN F420_oxidored 3HCDH_N NAD_binding_7 ACT_4 UDPG_MGDP_dh_N UDPG_MGDP_dh_C
Motif
Other DBs
NCBI-GeneID: 910062
NCBI-ProteinID: NP_302163
Pasteur: ML1692
UniProt: O33116
Position
complement(2038215..2039801)
Genome map
AA seq 528 aa AA seqDB search
MDLPVVLIADKLAQSTVAALGDQVEVRWVDGPDRTKLLAAVPEADALLVRSATTVDAEVL
AAAPKLKIVARAGVGLDNVDVDAATARGVLVVNAPTSNIHSAAEHALALLLAASRQIAEA
DASLRAHIWKRSSFSGTEIFGKTVGVVGLGRIGQLVAARIAAFGAHVIAYDPYVAPARAA
QLGIELMSFDDLLARADFISVHLPKTPETAGLIDKEALAKTKPGVIIVNAARGGLVDEVA
LADAVRSGHVRAAGLDVFATEPCTDSPLFELSQVVVTPHLGASTAEAQDRAGTDVAESVR
LALAGEFVPDAVNVDGGVVNEEVAPWLDLVCKLGVLVAALSDELPASLSVHVRGELASED
VEILRLSALRGLFSTVIEDAVTFVNAPALAAERGVSAEITTGSESPNHRSVVDVRAVASD
GSVVNIAGTLSGPQLVQKIVQVNGRNFDLRAQGMNLVIRYVDQPGALGKIGTLLGAAGVN
IQAAQLSEDTEGPGATILLRLDQDVPGDVRSAIVAAVSANKLEVVNLS
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgcctgttgtgttaattgccgacaaactcgcccaatcaaccgtggctgccctg
ggagaccaagtcgaggtgcggtgggtggacggtccagaccggacgaagctgttagctgca
gtacccgaggccgacgcgttgttggtgcggtcggccactactgtcgacgccgaggtgctg
gcagccgctcctaagctcaagatcgtcgcccgtgccggggtagggctagacaacgttgat
gtcgatgccgccaccgcgcgcggtgtcctggtagtcaacgccccaacgtcgaacattcac
agcgccgctgagcacgcgttggcgctgctattggcagcttctcggcagatcgcggaggcc
gacgcctcactgcgtgcacacatctggaaacggtcgtcgttctccggcaccgaaattttc
ggcaagaccgtcggcgtggtggggctgggtcggattgggcagttggttgccgcacggata
gcagcgttcggggctcacgttatcgcttacgacccgtatgtggcgccggcacgggccgcg
cagcttggtatcgagctgatgtcttttgacgatctcctagcccgggccgattttatctca
gtgcatttgccgaagacgcccgagacggcgggcctgatcgacaaggaggcgctggccaaa
accaagcccggtgtcatcattgtcaatgccgcacgcggcggcttagtggacgaggtggcg
ctagccgatgcggtgcgcagcggacatgttcgggcggccggtctagatgtgtttgccacc
gaaccgtgcaccgatagcccgctgtttgaactatcgcaggtggtggtgacaccgcatctg
ggggcgtctaccgccgaagcccaggatcgagcaggtactgatgtggccgaaagcgtgcgg
ctggcgctggcgggggagtttgtgcctgacgcggtcaacgtggacgggggcgtggtcaac
gaagaggtggctccctggctggacttggtgtgcaagcttggggtgctggtagccgcgtta
tccgatgaactgccggcgtcgttgtcggtgcacgtgcgtggcgagttggcttctgaagac
gttgaaatattgcggctttcggccctacgtgggcttttctcgacggtcatagaggatgct
gtgacgttcgtcaacgcaccggcactggccgccgaacgaggtgtgtccgctgaaatcact
acgggctcggagagccccaaccatcgcagtgtggtcgacgtgcgggcggtcgcctccgac
ggctcggtggtcaacatagccggtacgttgtctgggccgcaactggtgcagaagatcgtg
caggtcaatggtcgtaactttgatttgcgtgcgcagggcatgaacttggtgatcaggtat
gtcgaccaacctggcgctctgggcaagattggcactttgctgggcgcggccggggtgaat
atccaagctgctcagctgtctgaggacaccgaggggccaggtgcgacgattctgttgagg
ctggatcaagacgtgccgggtgatgtgcggtcggcgatcgtggcagcggtgagtgccaac
aagcttgaggtagtcaatctgtcatga

DBGET integrated database retrieval system