KEGG   Mycobacterium leprae TN: ML2402Help
Entry
ML2402            CDS       T00047                                 

Definition
(RefSeq) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mle  Mycobacterium leprae TN
Pathway
mle00071  Fatty acid degradation
mle00280  Valine, leucine and isoleucine degradation
mle00281  Geraniol degradation
mle00310  Lysine degradation
mle00360  Phenylalanine metabolism
mle00362  Benzoate degradation
mle00380  Tryptophan metabolism
mle00410  beta-Alanine metabolism
mle00627  Aminobenzoate degradation
mle00640  Propanoate metabolism
mle00650  Butanoate metabolism
mle00903  Limonene and pinene degradation
mle00930  Caprolactam degradation
mle01100  Metabolic pathways
mle01110  Biosynthesis of secondary metabolites
mle01120  Microbial metabolism in diverse environments
mle01130  Biosynthesis of antibiotics
mle01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mle00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ML2402
   00650 Butanoate metabolism
    ML2402
  Lipid metabolism
   00071 Fatty acid degradation
    ML2402
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ML2402
   00310 Lysine degradation
    ML2402
   00360 Phenylalanine metabolism
    ML2402
   00380 Tryptophan metabolism
    ML2402
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ML2402
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ML2402
   00281 Geraniol degradation
    ML2402
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ML2402
   00627 Aminobenzoate degradation
    ML2402
   00930 Caprolactam degradation
    ML2402
Enzymes [BR:mle01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ML2402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 908604
NCBI-ProteinID: NP_302555
Pasteur: ML2402
UniProt: O07137
Position
2872831..2873604
Genome map
AA seq 257 aa AA seqDB search
MKYDTILVDGYQRVGIITLNRPQALNALNSQMMNEITNAAKELDIDPDVGAILITGSPKV
FAAGADIKEMASLTFTDAFDADFFSAWGKLAAVRTPMIAAVAGYALGGGCELAMMCDLLI
AADTAKFGQPEIKLGVLPGMGGSQRLTRAIGKAKAMDLILTGRTIDAAEAERSGLVSRVV
LADDLLPEAKAVATTISQMSRSATRMAKEAVNRSFESTLAEGLLHERRLFHSTFVTDDQS
EGMAAFIEKRAPQFTHR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacgacacaatcctcgttgacggctaccagcgagttggcatcatcacactgaac
cggccacaggctctgaacgcactcaatagccagatgatgaacgaaatcactaatgcagca
aaagaattagacatcgatcccgatgttggggcgatcctcattactggttcacccaaggtt
tttgctgccggcgccgacatcaaagagatggccagtttaacgttcaccgacgcatttgac
gctgattttttctccgcatggggcaagctggccgccgtgcgtaccccaatgatcgccgcg
gtggccggatatgcactcggtggtggctgcgagttagcgatgatgtgcgatctgcttatc
gccgccgacacagcgaaattcggtcagccagaaatcaaactcggcgttctgcccggtatg
ggaggctcccagcgcctaacccgagcgatcggcaaggccaaagcaatggacctgatcttg
accggacgcaccatcgacgcggccgaagccgaacgcagcggcctggtttcgcgggtggtg
ctggccgacgatttactgcccgaggccaaggctgtcgctactaccatttcgcagatgtct
cggtcggctacccggatggccaaggaagcagtcaatcggtctttcgaatccacgctggct
gaaggattgctccacgaacgccggcttttccattcgaccttcgtgacagacgaccagtcc
gagggcatggcggcattcatcgagaaacgcgctccccagtttacccaccgatga

DBGET integrated database retrieval system