KEGG   Mycobacterium liflandii: MULP_01340Help
Entry
MULP_01340        CDS       T02444                                 

Gene name
nagA
Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase NagA
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
mli  Mycobacterium liflandii
Pathway
mli00520  Amino sugar and nucleotide sugar metabolism
mli01100  Metabolic pathways
mli01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MULP_01340 (nagA)
Enzymes [BR:mli01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     MULP_01340 (nagA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AGC61315
UniProt: L7V449
Position
complement(1441220..1442386)
Genome map
AA seq 388 aa AA seqDB search
MTLICAGSVVIDGELCRPGWIRTAGHKIADCGTGTAPLADFDFPDSIVVPGFVDIHVHGG
AGASFADADAGGRALIQASEFHLRHGTTTMLASLVTAAPAQLLSAVAKLAEAISSGRSGT
IAGIHLEGPWLSPARCGAHDHTQVRAPDPAEIDALLAAANGTIRMVTLAPELPGSADTIR
RFLAAGVVVALGHTDATYEQTCQAIGHGATVATHLFNAMAPLGHREPGPALALLKDPAVT
LELIADGVHVHPAVVAAVIEAVGPDRVALVTDAIAAAGCGDGTYRLGSVPIEVESNVARV
CGTPTIAGSTATMDRLFRAAFRAGAGAALDAGALAAAVQMTSATPARAVGLARRGSLRAG
FDANLVVLDRDLRVAAVMANGEWQAVED
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtgaccctcatctgtgccgggtctgtggtcatcgacggagaactttgccgacccggctgg
atacggacggcgggccacaaaatcgcggattgcggcaccggcacagcgcctttggccgac
ttcgacttcccggactcgatcgtggtgccggggttcgtcgacatccacgtgcacggcgga
gcgggcgcgtcgttcgccgacgccgacgccggtggccgggccttgatccaagccagcgag
tttcacctgcgccacggcaccaccacgatgctggccagcctggtcaccgccgcacccgcg
caactgctttcggcggtagccaagctggccgaagccatcagctcgggccgctcgggcacc
atcgcaggcatccatctggagggcccgtggctgagccccgcacggtgcggcgcgcacgac
cacacccaagtgcgtgcgccggaccccgccgaaatcgatgcgctgctggcggccgccaac
ggcaccatccgcatggtgacgctggccccggaattgcccggatccgccgacacgataagg
cgcttcttggccgccggtgtggtggtggccctcgggcacaccgatgcgacctacgagcag
acctgccaggccatcggccacggtgccaccgtcgccactcacctgttcaacgcgatggcg
cccctgggccaccgcgagcccgggcccgccctggcattgctgaaggacccggcggtgacg
ctcgaattgatcgccgacggggtacacgtccatcccgccgtggtggcggccgtgatcgag
gccgtcggccccgaccgggtcgcgttggtcaccgacgcgatagccgcggccggatgtggc
gatggcacatatcgtctgggatcggtgccgattgaggtcgagtcgaacgtggcgcgggtg
tgtggcaccccgacgatcgcgggcagcacggccaccatggaccggctctttcgcgccgca
tttcgggctggggcgggggccgcactcgatgccggggcgctggccgccgcggtgcagatg
acctcggcgaccccggcgcgcgccgtcgggctggcacgacggggcagcctgcgggccggc
tttgacgccaatctcgttgtgctcgatcgcgatctgcgcgtggccgcggtgatggccaac
ggcgagtggcaggccgtcgaggactag

DBGET integrated database retrieval system