KEGG   Mycobacterium liflandii: MULP_03016Help
Entry
MULP_03016        CDS       T02444                                 

Gene name
fucA_2
Definition
(GenBank) class II aldolase/adducin domain protein
  KO
K01628  L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mli  Mycobacterium liflandii
Pathway
mli00051  Fructose and mannose metabolism
mli01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mli00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MULP_03016 (fucA_2)
Enzymes [BR:mli01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     MULP_03016 (fucA_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldolase_II Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: AGC62751
UniProt: L7V4L7
Position
complement(3236871..3237656)
Genome map
AA seq 261 aa AA seqDB search
MATTFSDSKSELMRRAQERLDAQTPESQLTTRQKVALTCRALFDAGHDSGLAGQITARAQ
RPGTYYTQQLGLGFDEITEDNLLLVDEDLNVLEGSAMANPANRFHSWIYRERPDVQCIVH
THGFHTAALSMLKVPLVVSHMDTTPLYDDCAFLADWPGVPVGNEEGEIISAALGNKKAIL
LAHHGQLIAGVSIEEACTLAVLIERAAKLQLAAMSAGTIAELPDQLAREAHDWTLTPSRS
RANFAYYARRALARHPDALSS
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccactttctccgattccaagtccgaattgatgcgacgggcccaggaacgcctc
gatgcccagacgcccgaatctcagctgaccacccggcaaaaggtcgcgttgacctgccgg
gcattgttcgacgccggccacgattccggtctggccgggcagatcaccgcgcgtgcgcag
cggcccggcacctattacacccaacaactcggcttgggattcgacgagatcaccgaagac
aacttgctgttggtcgacgaggacctcaatgttctcgagggctccgcaatggccaacccg
gcaaatcgatttcacagctggatctaccgcgaacggccggacgtgcagtgcatcgttcat
acccatgggttccacaccgcggcgttgtcgatgctgaaggtgccgctggtcgtttcgcac
atggacaccacgccgctctatgacgactgcgctttcctcgccgactggccaggcgtgccg
gtgggtaacgaggaaggcgagatcatcagcgccgcattgggaaacaagaaggcgatcctt
cttgcgcaccacgggcagttgatagccggcgtcagcatcgaggaggcctgcacgctggcg
gtcctgatcgaacgcgccgccaaactgcaactggcggccatgagtgcgggaacaatcgcc
gaactaccggaccaactggcccgcgaggctcacgattggaccctgacaccttcccgcagc
cgggcgaactttgcctactacgcgcgtcgcgcactggcccgtcaccccgatgcgctgagc
agctga

DBGET integrated database retrieval system