KEGG   Mycobacterium liflandii: MULP_04697Help
Entry
MULP_04697        CDS       T02444                                 

Gene name
metS
Definition
(GenBank) methionyl-tRNA synthetase MetS
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
mli  Mycobacterium liflandii
Pathway
mli00450  Selenocompound metabolism
mli00970  Aminoacyl-tRNA biosynthesis
mli01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mli00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    MULP_04697 (metS)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MULP_04697 (metS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mli01007]
    MULP_04697 (metS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mli03016]
    MULP_04697 (metS)
Enzymes [BR:mli01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     MULP_04697 (metS)
Amino acid related enzymes [BR:mli01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   MULP_04697 (metS)
Transfer RNA biogenesis [BR:mli03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MULP_04697 (metS)
 Prokaryotic type
   Other AARSs
    MULP_04697 (metS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f TFIIF_alpha DUF3099
Motif
Other DBs
NCBI-ProteinID: AGC64210
UniProt: L7VCD6
Position
5113019..5114575
Genome map
AA seq 518 aa AA seqDB search
MKPYYVTTAIAYPNAAPHVGHAYEYIATDAIARFKRLDGFDVRFLTGTDEHGLKVAQAAA
AADIPTAQLARRNSDVFQRMQEALNISFDRFIRTTDSDHYEASQEIWRRMDAAGDIYLDS
YSGWYSVRDERFFVESETQVVDGTRIATETGTPVTWTEEQTYFFRLSAYADKLLAHYEAN
PDFIAPEVRRNEVVSFVSGGLKDLSVSRTSFNWGVPVPGHPDHVMYVWVDALTNYLTGAG
YPDTGSEAFLRYWPADLHMIGKDIIRFHAVYWPAFLMSAGIELPRRVFAHGFLHNRGEKM
SKSLGNTIDPMGLIETYGVDQVRYFLLREVPFGQDGSYSEEAIINRINTDLANELGNLAQ
RSLSMIAKNLGGAVPEPGEFSAADRELLAIADGLLERVREHFDNQSMHLALEAIWLMLGH
ANKYFSDQQPWVLRKSESETDQARFRTTLYTTCEAVRIAALLVAPVMPESAAKLLDLLGQ
RPDQRSFNAIGARLVPGTAMPSPTGVFPRYQPPPSETG
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgaagccctattacgtcaccactgcgatcgcgtatcccaacgccgcaccgcacgtgggt
catgcatacgaatacatcgccaccgacgcgattgcccggttcaagcggctcgacggcttc
gacgtccgcttcttgaccgggaccgacgagcacgggctgaaggtggcgcaagccgccgcg
gccgcggacatcccgaccgcgcagctggcccggcgcaattcggatgtgttccagcgcatg
caggaagcgttgaacatctccttcgaccggttcattcgcaccaccgattccgaccactac
gaggcctcccaggagatctggcggcgcatggatgctgccggcgacatctatctggacagc
tattccggctggtactcggtgcgcgatgaaaggttcttcgtcgagtcggagacccaagtt
gtcgacggcacccggatagccaccgaaaccggaaccccggtgacctggaccgaggagcag
acctacttcttccggctgtcggcctacgccgacaaactgctggcgcactacgaagccaac
ccggatttcatcgcgcccgaggtgcggcgcaacgaggtggtcagcttcgtctccggtggg
ctcaaagacctatcggtctcccgcacgtcgttcaactggggcgttccggtacccggacat
cccgaccacgtcatgtacgtgtgggtcgacgcgctgaccaactatctgaccggggccggc
tacccggataccggctcggaggccttcctgcgctactggccggctgatctgcacatgatc
ggcaaggacatcatccggttccacgccgtctactggccggcattcttgatgtcggccggc
atcgagctgccgcgccgggttttcgcgcacgggttcttgcacaaccgcggcgaaaagatg
agcaagtcgctgggcaacaccatcgacccgatgggcctgatcgaaacgtatggagtggac
caggttcgctacttcttactgcgcgaggtcccattcgggcaggacggcagctacagcgaa
gaagccatcatcaaccggatcaacaccgatctggccaacgagctgggaaacctggcccag
cggtcgttgtcgatgatcgccaagaacctgggcggggcggtacccgagcccggcgaattc
tccgccgccgacagggagctgctggcgatcgccgacgggctgctggaacgggtgcgcgaa
cacttcgacaatcagtcgatgcaccttgctctggaagcgatttggctgatgctcggccat
gcgaacaaatacttttccgaccagcagccgtgggtgctgcgcaagagcgagtccgagacc
gaccaagcccggttccgcacgacgctctacaccacatgtgaggccgtgcgcatcgcggcg
ctactggttgcgccggtcatgccggagtcggccgccaagttgttggacctgctgggccag
cggccagatcagcggtcgttcaacgccatcggcgcccgcctggtcccgggcaccgcgatg
ccgtcgcccaccggtgtattcccgcgctaccagccgccgccttccgaaaccgggtaa

DBGET integrated database retrieval system